(data stored in ACNUC7421 zone)

EMBL: CP000821.PE397

CP000821.PE397       Location/Qualifiers
FT   CDS             464841..466178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0397"
FT                   /product="long-chain fatty acid transport protein"
FT                   /note="KEGG: son:SO4232 long-chain fatty acid transport
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35010"
FT                   /db_xref="InterPro:IPR005017"
FT                   /db_xref="InterPro:IPR042117"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ87"
FT                   /protein_id="ABV35010.1"
FT                   /translation="MTLKMRETMNKRILSMAVAAAIVGSVTQVQAAGFQLAEYSATGLG
FT                   RAFAGEAAMADNAAAQFRNPAMMTYLSGTQVAGGAILVMPNIDINGEVTFVDGTNPTSA
FT                   NDIADDAVVPNFYVTHQLNEQWFLGLALGSNFGMATELDDSFRGTQFGNEASVTTIEIN
FT                   PNIAYRINEQFSVGAGVRFVIGEGSIGAKSSADSVLPTPMGNLPVPKGTTLKYMEGDDT
FT                   SWGWQLGAAWQINDSNRIGVNYRSAVDQNLEGEANGLAFNPMDPTLKMDGAMELSLPAT
FT                   AELASFHQLTEKLAIHASINWTDWSSFEKLEAVIPALSEPTQLVKQENWKDSYRFALGT
FT                   TYDLSQKSTLRAGVAYDRSAVSDANRTLTIPEMDRLWLSAGYGYHYSDNLDLDFGVTYI
FT                   FADESPVVEPRPGIESDRSSALFGGTFSGTTSGNIMLVGVQASYRF"
     MTLKMRETMN KRILSMAVAA AIVGSVTQVQ AAGFQLAEYS ATGLGRAFAG EAAMADNAAA        60
     QFRNPAMMTY LSGTQVAGGA ILVMPNIDIN GEVTFVDGTN PTSANDIADD AVVPNFYVTH       120
     QLNEQWFLGL ALGSNFGMAT ELDDSFRGTQ FGNEASVTTI EINPNIAYRI NEQFSVGAGV       180
     RFVIGEGSIG AKSSADSVLP TPMGNLPVPK GTTLKYMEGD DTSWGWQLGA AWQINDSNRI       240
     GVNYRSAVDQ NLEGEANGLA FNPMDPTLKM DGAMELSLPA TAELASFHQL TEKLAIHASI       300
     NWTDWSSFEK LEAVIPALSE PTQLVKQENW KDSYRFALGT TYDLSQKSTL RAGVAYDRSA       360
     VSDANRTLTI PEMDRLWLSA GYGYHYSDNL DLDFGVTYIF ADESPVVEPR PGIESDRSSA       420
     LFGGTFSGTT SGNIMLVGVQ ASYRF                                             445
//

If you have problems or comments...

PBIL Back to PBIL home page