(data stored in ACNUC7421 zone)

EMBL: CP000821.PE398

CP000821.PE398       Location/Qualifiers
FT   CDS             466420..466917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0398"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_3467 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35011"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ88"
FT                   /protein_id="ABV35011.1"
FT                   /translation="MRSYLLAASLTFLSFTSQAAPTPTEVVESFIQAYNKHDVELMVQH
FT                   TSETVRWMHITGTKVEVETSDRTEFGAAMTDYFETLKDANATILQIIDSGSYVSTVERV
FT                   TWDNDGEHLSQCSIGTFRVKAGKLAEFWYFPAHACDEQPPQEMIEQDVVEPEIGVLQET
FT                   QQ"
     MRSYLLAASL TFLSFTSQAA PTPTEVVESF IQAYNKHDVE LMVQHTSETV RWMHITGTKV        60
     EVETSDRTEF GAAMTDYFET LKDANATILQ IIDSGSYVST VERVTWDNDG EHLSQCSIGT       120
     FRVKAGKLAE FWYFPAHACD EQPPQEMIEQ DVVEPEIGVL QETQQ                       165
//

If you have problems or comments...

PBIL Back to PBIL home page