(data stored in ACNUC7421 zone)

EMBL: CP000821.PE399

CP000821.PE399       Location/Qualifiers
FT   CDS             466976..468463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0399"
FT                   /product="glycerol kinase"
FT                   /note="KEGG: slo:Shew_3466 glycerol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35012"
FT                   /db_xref="GOA:A8FQ89"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR005999"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8FQ89"
FT                   /protein_id="ABV35012.1"
FT                   /translation="MAKKYVVALDQGTTSSRAIIFDHDANIVSVSQREFPQIYPQAGWV
FT                   EHDPMEIWASQSSTLIELLARSGIHGSEVAAIGITNQRETTVIWDKLTGKPVYNAIVWQ
FT                   CRRSSHICDELKAQGLEDYVRETTGLLLDPYFSGTKIKWILDNVAGVRERAEKGELLFG
FT                   TIDTWLVWKLTEGKVHVTDPTNASRTLLFNIHTQQWDSKLLEALNIPESLLPEVKPSCA
FT                   VYGKTRIAGEGGEISIAGIAGDQQSALFGQLCIDEGMAKNTYGTGCFLLMNTGKQAVKS
FT                   THGLLTTVAIGADCEVNYALEGAVFMGGATIQWLRDELGLIRDAQDTEYFASKVEDTNG
FT                   VYLVPAFVGLGAPYWDPNARGALVGLTRGSNRNHIIRAALEAIAYQSRDLLDAMAKDSG
FT                   VMLKQLKVDGGAVSNDFLMQFQADITNVEVQRPAITETTAMGAAFLAGLAVGFWSSTSE
FT                   LKHKADIERTFIPSISAEKCDELYCGWNRAVTQTIKS"
     MAKKYVVALD QGTTSSRAII FDHDANIVSV SQREFPQIYP QAGWVEHDPM EIWASQSSTL        60
     IELLARSGIH GSEVAAIGIT NQRETTVIWD KLTGKPVYNA IVWQCRRSSH ICDELKAQGL       120
     EDYVRETTGL LLDPYFSGTK IKWILDNVAG VRERAEKGEL LFGTIDTWLV WKLTEGKVHV       180
     TDPTNASRTL LFNIHTQQWD SKLLEALNIP ESLLPEVKPS CAVYGKTRIA GEGGEISIAG       240
     IAGDQQSALF GQLCIDEGMA KNTYGTGCFL LMNTGKQAVK STHGLLTTVA IGADCEVNYA       300
     LEGAVFMGGA TIQWLRDELG LIRDAQDTEY FASKVEDTNG VYLVPAFVGL GAPYWDPNAR       360
     GALVGLTRGS NRNHIIRAAL EAIAYQSRDL LDAMAKDSGV MLKQLKVDGG AVSNDFLMQF       420
     QADITNVEVQ RPAITETTAM GAAFLAGLAV GFWSSTSELK HKADIERTFI PSISAEKCDE       480
     LYCGWNRAVT QTIKS                                                        495
//

If you have problems or comments...

PBIL Back to PBIL home page