(data stored in ACNUC7421 zone)

EMBL: CP000821.PE4

CP000821.PE4         Location/Qualifiers
FT   CDS             complement(3859..4221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0004"
FT                   /product="ribonuclease P protein component"
FT                   /note="KEGG: sfr:Sfri_4065 ribonuclease P protein
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34617"
FT                   /db_xref="GOA:A8FP44"
FT                   /db_xref="InterPro:IPR000100"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020539"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:A8FP44"
FT                   /protein_id="ABV34617.1"
FT                   /translation="MQVTSYTFTRELRLLTPAQFKSVFTKPIKASSAEITLLAIPNSEQ
FT                   HPRLGLTVAKRFVKKAHQRNRIKRIIRDNFRLHQHELPPIDIVVLVRNGVVEMENTDLH
FT                   KLVEKLWRKLNRRYNG"
     MQVTSYTFTR ELRLLTPAQF KSVFTKPIKA SSAEITLLAI PNSEQHPRLG LTVAKRFVKK        60
     AHQRNRIKRI IRDNFRLHQH ELPPIDIVVL VRNGVVEMEN TDLHKLVEKL WRKLNRRYNG       120
//

If you have problems or comments...

PBIL Back to PBIL home page