(data stored in ACNUC7421 zone)

EMBL: CP000821.PE40

CP000821.PE40        Location/Qualifiers
FT   CDS             47275..47838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0040"
FT                   /product="DNA topoisomerase, type IA, Zn finger domain
FT                   protein"
FT                   /note="KEGG: slo:Shew_3731 DNA topoisomerase, type IA, Zn
FT                   finger domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34653"
FT                   /db_xref="GOA:A8FP80"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR013498"
FT                   /db_xref="UniProtKB/TrEMBL:A8FP80"
FT                   /protein_id="ABV34653.1"
FT                   /translation="MSKIDQQLFSSHEHALEKEFELCPKCGCELSIKNSKHGGFIGCNN
FT                   YPTCDYTRPLVQHESIETQVIEGSQCPECGHELAVKSGRFGIFIGCTQYPECKHIEKQD
FT                   QEVGGEEIPCPICTKGHIEHRTNRFGKSFYACSGYPKCKFLVNYPPVHETCPDCGFGIL
FT                   VERKGAAGARLECPKKQCKYKRAL"
     MSKIDQQLFS SHEHALEKEF ELCPKCGCEL SIKNSKHGGF IGCNNYPTCD YTRPLVQHES        60
     IETQVIEGSQ CPECGHELAV KSGRFGIFIG CTQYPECKHI EKQDQEVGGE EIPCPICTKG       120
     HIEHRTNRFG KSFYACSGYP KCKFLVNYPP VHETCPDCGF GILVERKGAA GARLECPKKQ       180
     CKYKRAL                                                                 187
//

If you have problems or comments...

PBIL Back to PBIL home page