(data stored in ACNUC7421 zone)

EMBL: CP000821.PE401

CP000821.PE401       Location/Qualifiers
FT   CDS             469277..469735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0401"
FT                   /product="MraZ protein"
FT                   /note="KEGG: slo:Shew_3462 MraZ protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35014"
FT                   /db_xref="GOA:A8FQ91"
FT                   /db_xref="InterPro:IPR003444"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR020603"
FT                   /db_xref="InterPro:IPR035642"
FT                   /db_xref="InterPro:IPR035644"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR038619"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8FQ91"
FT                   /protein_id="ABV35014.1"
FT                   /translation="MFRGASAINLDTKGRIAIPKRYREPLHAEFNSQIVITVDFQSPCL
FT                   LLYPFDEWSKIEAKLLLLSDTRATERAMKRLLLGYAHECELDGNGRILLPPPLRQYANL
FT                   EKRAMLVGQLNKFELWDETAWQKQIEQSRETIQSEEFADNERLADFSL"
     MFRGASAINL DTKGRIAIPK RYREPLHAEF NSQIVITVDF QSPCLLLYPF DEWSKIEAKL        60
     LLLSDTRATE RAMKRLLLGY AHECELDGNG RILLPPPLRQ YANLEKRAML VGQLNKFELW       120
     DETAWQKQIE QSRETIQSEE FADNERLADF SL                                     152
//

If you have problems or comments...

PBIL Back to PBIL home page