(data stored in ACNUC7421 zone)

EMBL: CP000821.PE403

CP000821.PE403       Location/Qualifiers
FT   CDS             470784..471098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0403"
FT                   /product="cell division protein FtsL"
FT                   /note="KEGG: slo:Shew_3460 cell division protein FtsL"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35016"
FT                   /db_xref="GOA:A8FQ93"
FT                   /db_xref="InterPro:IPR011922"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ93"
FT                   /protein_id="ABV35016.1"
FT                   /translation="MSKSQLNLPRIVLLDLWHHKWVLLLAIAVMVNAIAVVYTSHVSRK
FT                   YITQWDQMLQERDRLDIEWRNLLLEEQSQSEHSRITRIASKELEMSRPLPKEEIVVRVP
FT                   "
     MSKSQLNLPR IVLLDLWHHK WVLLLAIAVM VNAIAVVYTS HVSRKYITQW DQMLQERDRL        60
     DIEWRNLLLE EQSQSEHSRI TRIASKELEM SRPLPKEEIV VRVP                        104
//

If you have problems or comments...

PBIL Back to PBIL home page