(data stored in ACNUC7421 zone)

EMBL: CP000821.PE409

CP000821.PE409       Location/Qualifiers
FT   CDS             478235..479467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0409"
FT                   /product="cell division protein FtsW"
FT                   /note="KEGG: slo:Shew_3454 cell division protein FtsW"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35022"
FT                   /db_xref="GOA:A8FQ99"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR013437"
FT                   /db_xref="InterPro:IPR018365"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8FQ99"
FT                   /protein_id="ABV35022.1"
FT                   /translation="MRSEERQLNLFGTSVNWSWPNLFKEREAPGMQLYDRALLFAVLSL
FT                   ICFGFVMVMSASMPEAQSLTGNPYHFAIRHFAYLVGCAVIAAVVLRIEMSRWQQFSPLL
FT                   LLIVGIMLVAVLLVGTSVNGATRWLSVGPIRIQVAELAKFAFTIYMAGYLVRRHQEIRE
FT                   NAKGFYKPIAVFAVYAFLILMQPDLGTVVVLFVGTVGLLFLAGARLLDFFALILTGVMA
FT                   FVALVLLEPYRMRRVTSFMDPWQDPFGSGYQLTQSLMAYGRGDWFGQGLGNSIQKLEYL
FT                   PEAHTDFIFAVIGEELGFIGIVVVLSVLLFVALRAIKLGNLCIEIDKPFEGYLAYAIGI
FT                   WFCFQTVVNVGASIGMLPTKGLTLPFISYGGSSLWVMTAAAMILIRIDHERRLSSIQAV
FT                   QGKKVNDNREY"
     MRSEERQLNL FGTSVNWSWP NLFKEREAPG MQLYDRALLF AVLSLICFGF VMVMSASMPE        60
     AQSLTGNPYH FAIRHFAYLV GCAVIAAVVL RIEMSRWQQF SPLLLLIVGI MLVAVLLVGT       120
     SVNGATRWLS VGPIRIQVAE LAKFAFTIYM AGYLVRRHQE IRENAKGFYK PIAVFAVYAF       180
     LILMQPDLGT VVVLFVGTVG LLFLAGARLL DFFALILTGV MAFVALVLLE PYRMRRVTSF       240
     MDPWQDPFGS GYQLTQSLMA YGRGDWFGQG LGNSIQKLEY LPEAHTDFIF AVIGEELGFI       300
     GIVVVLSVLL FVALRAIKLG NLCIEIDKPF EGYLAYAIGI WFCFQTVVNV GASIGMLPTK       360
     GLTLPFISYG GSSLWVMTAA AMILIRIDHE RRLSSIQAVQ GKKVNDNREY                  410
//

If you have problems or comments...

PBIL Back to PBIL home page