(data stored in ACNUC7421 zone)

EMBL: CP000821.PE41

CP000821.PE41        Location/Qualifiers
FT   CDS             47939..48496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0041"
FT                   /product="SUA5/YciO/YrdC/YwlC family protein"
FT                   /note="KEGG: slo:Shew_3730 SUA5/YciO/YrdC/YwlC family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34654"
FT                   /db_xref="GOA:A8FP81"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR023535"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8FP81"
FT                   /protein_id="ABV34654.1"
FT                   /translation="MLEQAPDEVQEIIEQGGVVAYPTEAVYGLGCDPDNDEAITRLLAL
FT                   KKRPWQKGLILVASDYQQLLPYIDESRLTNEQLNKVFVKWPGPFTFIMPIKPGLSNLLC
FT                   GSFNSLAVRVSSHPTIQAICQRLGKPLVSTSANHAGEPPAMSCEEIIAKFDGEIDALIS
FT                   GSLGAERKPSTIVDAISGKVLR"
     MLEQAPDEVQ EIIEQGGVVA YPTEAVYGLG CDPDNDEAIT RLLALKKRPW QKGLILVASD        60
     YQQLLPYIDE SRLTNEQLNK VFVKWPGPFT FIMPIKPGLS NLLCGSFNSL AVRVSSHPTI       120
     QAICQRLGKP LVSTSANHAG EPPAMSCEEI IAKFDGEIDA LISGSLGAER KPSTIVDAIS       180
     GKVLR                                                                   185
//

If you have problems or comments...

PBIL Back to PBIL home page