(data stored in ACNUC7421 zone)

EMBL: CP000821.PE412

CP000821.PE412       Location/Qualifiers
FT   CDS             482148..482912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0412"
FT                   /product="polypeptide-transport-associated domain protein,
FT                   FtsQ-type"
FT                   /note="KEGG: slo:Shew_3451 polypeptide-transport-associated
FT                   domain protein, FtsQ-type"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35025"
FT                   /db_xref="GOA:A8FQA2"
FT                   /db_xref="InterPro:IPR005548"
FT                   /db_xref="InterPro:IPR013685"
FT                   /db_xref="InterPro:IPR026579"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQA2"
FT                   /protein_id="ABV35025.1"
FT                   /translation="MSWAEVGQRWKLRLVQVDWYLCLGLLFLLLVVISLSMGAWKLNLI
FT                   VNDADALPIEAVAIRGERARTSDEEIQVALQDLMKRSFFSADVNQVQDALEALPWVYQA
FT                   SVRREWPAKLKVYLVEQQVVAHWNGDAWLNIHGQIFDAPKRSDIGALPLLAGPEGQSKV
FT                   VLTTYRQVSELLKINGFKLDSLSLSPRHAWHGSLDNGIMLELGREDKMARIQRFINVYP
FT                   TLVKQSKPVAKVDLRYDTGLAVGWENAQKESQ"
     MSWAEVGQRW KLRLVQVDWY LCLGLLFLLL VVISLSMGAW KLNLIVNDAD ALPIEAVAIR        60
     GERARTSDEE IQVALQDLMK RSFFSADVNQ VQDALEALPW VYQASVRREW PAKLKVYLVE       120
     QQVVAHWNGD AWLNIHGQIF DAPKRSDIGA LPLLAGPEGQ SKVVLTTYRQ VSELLKINGF       180
     KLDSLSLSPR HAWHGSLDNG IMLELGREDK MARIQRFINV YPTLVKQSKP VAKVDLRYDT       240
     GLAVGWENAQ KESQ                                                         254
//

If you have problems or comments...

PBIL Back to PBIL home page