(data stored in ACNUC7421 zone)

EMBL: CP000821.PE413

CP000821.PE413       Location/Qualifiers
FT   CDS             482916..484151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0413"
FT                   /product="cell division protein FtsA"
FT                   /note="KEGG: slo:Shew_3450 cell division protein FtsA"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35026"
FT                   /db_xref="GOA:A8FQA3"
FT                   /db_xref="InterPro:IPR003494"
FT                   /db_xref="InterPro:IPR020823"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQA3"
FT                   /protein_id="ABV35026.1"
FT                   /translation="MTKNQDRNLIVGLDIGTSKVAVIIGEVLPDGEISVVGLGNHQSRG
FT                   MDKGGVNDLDSIVRSVQRALDQAELMADCQVSSVYLGISGKHIDCQNENGMVSINDEEV
FT                   TQDDVDNVIHTARSVKIPTERRILHVLPQEYAIDVQDGIKSPIGMSGMRMEAKVHIVTC
FT                   ANDMAKNITKSVERCGLKVDDLVFSAIASADSVLTNDEKDLGVCLVDIGGGTTDLAVYT
FT                   NGALRHCAVVPVAGNQVTNDIAKIFRTPLSHAEQIKVQFASARSAMVSREDSIEVPSVG
FT                   GRPSRTMSRHTLAEVVEPRYQELFELVLKELRDSGLEDQIAAGIVLTGGTSSIEGTVDV
FT                   AEATFGMPVRVATPLPVKGLFEYVDQPIYSTGVGLLHYGARRVVERQFERPERQGVTSL
FT                   WNRVQSWFKGEF"
     MTKNQDRNLI VGLDIGTSKV AVIIGEVLPD GEISVVGLGN HQSRGMDKGG VNDLDSIVRS        60
     VQRALDQAEL MADCQVSSVY LGISGKHIDC QNENGMVSIN DEEVTQDDVD NVIHTARSVK       120
     IPTERRILHV LPQEYAIDVQ DGIKSPIGMS GMRMEAKVHI VTCANDMAKN ITKSVERCGL       180
     KVDDLVFSAI ASADSVLTND EKDLGVCLVD IGGGTTDLAV YTNGALRHCA VVPVAGNQVT       240
     NDIAKIFRTP LSHAEQIKVQ FASARSAMVS REDSIEVPSV GGRPSRTMSR HTLAEVVEPR       300
     YQELFELVLK ELRDSGLEDQ IAAGIVLTGG TSSIEGTVDV AEATFGMPVR VATPLPVKGL       360
     FEYVDQPIYS TGVGLLHYGA RRVVERQFER PERQGVTSLW NRVQSWFKGE F                411
//

If you have problems or comments...

PBIL Back to PBIL home page