(data stored in ACNUC7421 zone)

EMBL: CP000821.PE414

CP000821.PE414       Location/Qualifiers
FT   CDS             484228..485403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0414"
FT                   /product="cell division protein FtsZ"
FT                   /note="KEGG: slo:Shew_3449 cell division protein FtsZ"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35027"
FT                   /db_xref="GOA:A8FQA4"
FT                   /db_xref="InterPro:IPR000158"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR008280"
FT                   /db_xref="InterPro:IPR018316"
FT                   /db_xref="InterPro:IPR020805"
FT                   /db_xref="InterPro:IPR024757"
FT                   /db_xref="InterPro:IPR036525"
FT                   /db_xref="InterPro:IPR037103"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQA4"
FT                   /protein_id="ABV35027.1"
FT                   /translation="MFEIMDSHTDEAVIKVIGVGGGGGNAIEHMVKHNIEGVEFVATNT
FT                   DAQALRKSSAGSTIQLGRDITKGLGAGANPEIGRLAAEEDKENIRNAIKGSDMIFIAAG
FT                   MGGGTGTGAAPVVAEVAKEEGILTVAVVTKPFPFEGKKRMSYADQGIAELAKHVDSLIT
FT                   IPNEKLLKVLGRGTSLLDAFAAANNVLLGAVQGIAELITRPGLINVDFADVKTVMSEMG
FT                   NAMMGTGVASGEDRAEEAAEAAVASPLLEDIDLAGARGVLVNITAGMDMSIEEFETVGN
FT                   HVKAYASDNATVVVGAVIDPEMSDELRVTVVATGIGAEKKPDIQLVTKPAPRPEPIVTP
FT                   EVRPETASEEMIAQPMVTGNVVPVAQTAPAPAPKNEADYLDIPAFLRKQAD"
     MFEIMDSHTD EAVIKVIGVG GGGGNAIEHM VKHNIEGVEF VATNTDAQAL RKSSAGSTIQ        60
     LGRDITKGLG AGANPEIGRL AAEEDKENIR NAIKGSDMIF IAAGMGGGTG TGAAPVVAEV       120
     AKEEGILTVA VVTKPFPFEG KKRMSYADQG IAELAKHVDS LITIPNEKLL KVLGRGTSLL       180
     DAFAAANNVL LGAVQGIAEL ITRPGLINVD FADVKTVMSE MGNAMMGTGV ASGEDRAEEA       240
     AEAAVASPLL EDIDLAGARG VLVNITAGMD MSIEEFETVG NHVKAYASDN ATVVVGAVID       300
     PEMSDELRVT VVATGIGAEK KPDIQLVTKP APRPEPIVTP EVRPETASEE MIAQPMVTGN       360
     VVPVAQTAPA PAPKNEADYL DIPAFLRKQA D                                      391
//

If you have problems or comments...

PBIL Back to PBIL home page