(data stored in ACNUC7421 zone)

EMBL: CP000821.PE416

CP000821.PE416       Location/Qualifiers
FT   CDS             complement(486566..487018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0416"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_3447 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35029"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQA6"
FT                   /protein_id="ABV35029.1"
FT                   /translation="MKKPPQDLSQLLHQQGQMPNLAEKAELLLHLNHYVKQVLAGPVSQ
FT                   QLKVANLRQGVLVIETTSAAWAARINFQKAKILQQLQAETLPMLTAIEVKVNPSLVLYE
FT                   TKPKIPQHHISETAASHIEALAEHTEGSLAEKLKRLAALASRSRQS"
     MKKPPQDLSQ LLHQQGQMPN LAEKAELLLH LNHYVKQVLA GPVSQQLKVA NLRQGVLVIE        60
     TTSAAWAARI NFQKAKILQQ LQAETLPMLT AIEVKVNPSL VLYETKPKIP QHHISETAAS       120
     HIEALAEHTE GSLAEKLKRL AALASRSRQS                                        150
//

If you have problems or comments...

PBIL Back to PBIL home page