(data stored in ACNUC7421 zone)

EMBL: CP000821.PE418

CP000821.PE418       Location/Qualifiers
FT   CDS             488005..490728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0418"
FT                   /product="preprotein translocase, SecA subunit"
FT                   /note="KEGG: slo:Shew_3445 preprotein translocase, SecA
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35031"
FT                   /db_xref="GOA:A8FQA8"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036266"
FT                   /db_xref="InterPro:IPR036670"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8FQA8"
FT                   /protein_id="ABV35031.1"
FT                   /translation="MFGKILTKLFGSRNDRTLKSLGKTVTKINALEDEYEKLTDEELKA
FT                   KTTAFRGRLESGETLDDVMSEAFAVVREASKRVFEMRHFDVQMLGGMVLDSNRIAEMRT
FT                   GEGKTLTATLPAYLNGLTGKGVHVITVNDYLARRDAENNRPLFEFLGLSVGINVAGLGQ
FT                   QEKKAAYDADITYGTNNEFGFDYLRDNMAFSPQERVQRPLHYALIDEVDSILIDEARTP
FT                   LIISGAAEDSSELYTKINTLIPHLVRQDKEDTEEEIGDGDYSIDEKAKQVHMTERGQEK
FT                   VEVLLTERGMLAEGDSLYSAANISLLHHVNAALRAHTLFEKDVDYIVQDNEVIIVDEHT
FT                   GRTMPGRRWSEGLHQAVEAKEGVHIQNENQTLASITFQNFFRQYEKLAGMTGTADTEAF
FT                   EFQHIYGLDTVVIPTNRPMVRKDHADLVYLTPDEKYAAIIEDIRGCRERGQPVLVGTVS
FT                   IEQSELLARLMKQEKIPHEVLNAKFHEREADIVAQAGRTGAVTIATNMAGRGTDIVLGG
FT                   NWAMEIEVLTNPTDEQKAKIKTDWQVRHDEVVAAGGLHILGTERHESRRIDNQLRGRSG
FT                   RQGDAGSSRFYLSMEDSLMRIFASDRVSSMMKKLGMEKGEAIEHPWVSRAIENAQRKVE
FT                   ARNFDIRKQLLEFDDVANDQRQVVYAQRNELMDAESIQDTIVNIQADVVNGLVDQYIPQ
FT                   QSVEELWDVPGLQTRLEQEYGLKMPVQEWLDKEDDLHEETLRERIVDTWVKSYQAKEEM
FT                   VGEQVLRQFEKAVMLQTLDGLWKEHLAAMDHLRQGIHLRGYAQKNPKQEYKRESFELFQ
FT                   QMLETLKHDVISVLSKVQVQAQSDVEEMEERRRQEDAKIQRDYQHASAEAIVGAEEAES
FT                   LSAHTPVVREGEKVGRNDPCPCGSGRKYKQCHGKLT"
     MFGKILTKLF GSRNDRTLKS LGKTVTKINA LEDEYEKLTD EELKAKTTAF RGRLESGETL        60
     DDVMSEAFAV VREASKRVFE MRHFDVQMLG GMVLDSNRIA EMRTGEGKTL TATLPAYLNG       120
     LTGKGVHVIT VNDYLARRDA ENNRPLFEFL GLSVGINVAG LGQQEKKAAY DADITYGTNN       180
     EFGFDYLRDN MAFSPQERVQ RPLHYALIDE VDSILIDEAR TPLIISGAAE DSSELYTKIN       240
     TLIPHLVRQD KEDTEEEIGD GDYSIDEKAK QVHMTERGQE KVEVLLTERG MLAEGDSLYS       300
     AANISLLHHV NAALRAHTLF EKDVDYIVQD NEVIIVDEHT GRTMPGRRWS EGLHQAVEAK       360
     EGVHIQNENQ TLASITFQNF FRQYEKLAGM TGTADTEAFE FQHIYGLDTV VIPTNRPMVR       420
     KDHADLVYLT PDEKYAAIIE DIRGCRERGQ PVLVGTVSIE QSELLARLMK QEKIPHEVLN       480
     AKFHEREADI VAQAGRTGAV TIATNMAGRG TDIVLGGNWA MEIEVLTNPT DEQKAKIKTD       540
     WQVRHDEVVA AGGLHILGTE RHESRRIDNQ LRGRSGRQGD AGSSRFYLSM EDSLMRIFAS       600
     DRVSSMMKKL GMEKGEAIEH PWVSRAIENA QRKVEARNFD IRKQLLEFDD VANDQRQVVY       660
     AQRNELMDAE SIQDTIVNIQ ADVVNGLVDQ YIPQQSVEEL WDVPGLQTRL EQEYGLKMPV       720
     QEWLDKEDDL HEETLRERIV DTWVKSYQAK EEMVGEQVLR QFEKAVMLQT LDGLWKEHLA       780
     AMDHLRQGIH LRGYAQKNPK QEYKRESFEL FQQMLETLKH DVISVLSKVQ VQAQSDVEEM       840
     EERRRQEDAK IQRDYQHASA EAIVGAEEAE SLSAHTPVVR EGEKVGRNDP CPCGSGRKYK       900
     QCHGKLT                                                                 907
//

If you have problems or comments...

PBIL Back to PBIL home page