(data stored in ACNUC7421 zone)

EMBL: CP000821.PE419

CP000821.PE419       Location/Qualifiers
FT   CDS             complement(512380..512769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0419"
FT                   /product="mutator MutT protein"
FT                   /note="KEGG: slo:Shew_3444 mutator MutT protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35032"
FT                   /db_xref="GOA:A8FQA9"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR003561"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQA9"
FT                   /protein_id="ABV35032.1"
FT                   /translation="MKRIHVAVGVVLNNQNQVLLAKRPSHLHQGGKWEFPGGKVESGET
FT                   GSQALIRELREEVNLIVIATSPLMTISHDYPDKEVLLDIHTVNGYSGLAEGLEGQQVLW
FT                   ANVDKLGEYDFPEANTPIIDKLQSL"
     MKRIHVAVGV VLNNQNQVLL AKRPSHLHQG GKWEFPGGKV ESGETGSQAL IRELREEVNL        60
     IVIATSPLMT ISHDYPDKEV LLDIHTVNGY SGLAEGLEGQ QVLWANVDKL GEYDFPEANT       120
     PIIDKLQSL                                                               129
//

If you have problems or comments...

PBIL Back to PBIL home page