(data stored in ACNUC7421 zone)

EMBL: CP000821.PE421

CP000821.PE421       Location/Qualifiers
FT   CDS             complement(513065..513799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0421"
FT                   /product="protein of unknown function DUF1342"
FT                   /note="KEGG: slo:Shew_3442 protein of unknown function
FT                   DUF1342"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35034"
FT                   /db_xref="GOA:A8FQB1"
FT                   /db_xref="InterPro:IPR009777"
FT                   /db_xref="InterPro:IPR027462"
FT                   /db_xref="InterPro:IPR036268"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQB1"
FT                   /protein_id="ABV35034.1"
FT                   /translation="MTELIYEQPLNEKTRSYLRLEYLEQQLQTNLAHDHQHRCFYPLFS
FT                   LCELTERCDYRGEVLKDIDKQILQLSNWQNLPHIDSRQVSIYLSKLADAREALSVCERP
FT                   GSQLKLNRFLAALRQRFNMPGACCNFDLPQLHYWLAKPWDIRQYEYSEWIGHFTALLVP
FT                   IKLLLDLTRQTTEYSNAVATAGFFQGNSNQALSLIRVKLDSQQGCYPTISGHKNRYAIH
FT                   FVQFDQQKHSDRSIEFKLATCS"
     MTELIYEQPL NEKTRSYLRL EYLEQQLQTN LAHDHQHRCF YPLFSLCELT ERCDYRGEVL        60
     KDIDKQILQL SNWQNLPHID SRQVSIYLSK LADAREALSV CERPGSQLKL NRFLAALRQR       120
     FNMPGACCNF DLPQLHYWLA KPWDIRQYEY SEWIGHFTAL LVPIKLLLDL TRQTTEYSNA       180
     VATAGFFQGN SNQALSLIRV KLDSQQGCYP TISGHKNRYA IHFVQFDQQK HSDRSIEFKL       240
     ATCS                                                                    244
//

If you have problems or comments...

PBIL Back to PBIL home page