(data stored in ACNUC7421 zone)

EMBL: CP000821.PE422

CP000821.PE422       Location/Qualifiers
FT   CDS             complement(513808..514413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0422"
FT                   /product="Dephospho-CoA kinase"
FT                   /EC_number="2.7.1.24"
FT                   /note="KEGG: slo:Shew_3441 dephospho-CoA kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35035"
FT                   /db_xref="GOA:A8FQB2"
FT                   /db_xref="InterPro:IPR001977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQB2"
FT                   /protein_id="ABV35035.1"
FT                   /translation="MSKFIVGLTGGIGSGKTTVANMFAELGVELVDADIIAREVVEVGS
FT                   KGLNEISAHFGNTILNKDKSLNRATLRELIFSQPDERQWLNDLMHPMIRSKILKCIEST
FT                   TSPYAILVAPLLFENGLDRLVNLSLLVDISPEQQLDRTIDRDSVSSEQIKNIIDSQAPR
FT                   AERLSKADDVIDNHGKISALKGKVITLHNNYLKLANNT"
     MSKFIVGLTG GIGSGKTTVA NMFAELGVEL VDADIIAREV VEVGSKGLNE ISAHFGNTIL        60
     NKDKSLNRAT LRELIFSQPD ERQWLNDLMH PMIRSKILKC IESTTSPYAI LVAPLLFENG       120
     LDRLVNLSLL VDISPEQQLD RTIDRDSVSS EQIKNIIDSQ APRAERLSKA DDVIDNHGKI       180
     SALKGKVITL HNNYLKLANN T                                                 201
//

If you have problems or comments...

PBIL Back to PBIL home page