(data stored in ACNUC7421 zone)

EMBL: CP000821.PE423

CP000821.PE423       Location/Qualifiers
FT   CDS             complement(514459..515370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0423"
FT                   /product="Prepilin peptidase"
FT                   /EC_number="3.4.23.43"
FT                   /note="KEGG: shn:Shewana3_0417 peptidase A24A domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35036"
FT                   /db_xref="GOA:A8FQB3"
FT                   /db_xref="InterPro:IPR000045"
FT                   /db_xref="InterPro:IPR010627"
FT                   /db_xref="InterPro:IPR014032"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQB3"
FT                   /protein_id="ABV35036.1"
FT                   /translation="MSEFISILSQNLWLFSIISFIFSAVIGSFLNVVIHRFPVMLKREW
FT                   QQECNQYLNEYHEKLIAPISEQLNNPIDDYPERYNLVVPASACPKCKTNIKPWHNLPIV
FT                   GWLMLKGKCAACGTSISPRYPIIELLTGLAVALLAYHFGPGWEFIFATVLTFVLIALTG
FT                   IDLDEMLLPDQLTLPLLWLGLLINLNGTFASPTDAMIGAAAGYLSLWSVFWAFKLLTGK
FT                   EGMGYGDFKLLAVFGAWFGWQMLPLIILLSSLVGAIVGIGLIVTKKINKTNPIPFGPYI
FT                   AAAGWIAMIWGSDITNWYLSTL"
     MSEFISILSQ NLWLFSIISF IFSAVIGSFL NVVIHRFPVM LKREWQQECN QYLNEYHEKL        60
     IAPISEQLNN PIDDYPERYN LVVPASACPK CKTNIKPWHN LPIVGWLMLK GKCAACGTSI       120
     SPRYPIIELL TGLAVALLAY HFGPGWEFIF ATVLTFVLIA LTGIDLDEML LPDQLTLPLL       180
     WLGLLINLNG TFASPTDAMI GAAAGYLSLW SVFWAFKLLT GKEGMGYGDF KLLAVFGAWF       240
     GWQMLPLIIL LSSLVGAIVG IGLIVTKKIN KTNPIPFGPY IAAAGWIAMI WGSDITNWYL       300
     STL                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page