(data stored in ACNUC7421 zone)

EMBL: CP000821.PE424

CP000821.PE424       Location/Qualifiers
FT   CDS             complement(515443..516708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0424"
FT                   /product="type II secretion system protein"
FT                   /note="KEGG: slo:Shew_3439 type II secretion system
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35037"
FT                   /db_xref="GOA:A8FQB4"
FT                   /db_xref="InterPro:IPR001992"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQB4"
FT                   /protein_id="ABV35037.1"
FT                   /translation="MATATAGKAKKSKKKSAKAQPKVFTFEWKGVNRDGKKTSGELRGT
FT                   SAIEIKSQLKLQGVKPKAVRKKANSLFKSEKKITAMDIAMMTRQVATMLSAGVPIVTTL
FT                   ELLGRGHEKPKMRELLATIVGDVQSGIPLSDSLKPHRQYFDDLYVDLVAAGEHSGSLDA
FT                   VFDRIATYREKAEALKSKIKKAMFYPAAVVVVAIAVTALLLLFVVPQFEEIFQGFGAEL
FT                   PAFTQMIVDISRWLQASWYIFVIAIIIAVFSFKRAHLHSQSFRNRVDEFVLKIPAIGDI
FT                   LDKGAMARFARTLSTTFAAGVPLIDGLESSAGASGNYVYRSALLKVRQEVMAGMQMNVA
FT                   MRTTGLFPDMLIQMVMIGEESGGLDEMLNKVANIYEMQVDDAVDGLSSLIEPIMMVVIG
FT                   TLVGGLIVGMYLPIFQMGNVVG"
     MATATAGKAK KSKKKSAKAQ PKVFTFEWKG VNRDGKKTSG ELRGTSAIEI KSQLKLQGVK        60
     PKAVRKKANS LFKSEKKITA MDIAMMTRQV ATMLSAGVPI VTTLELLGRG HEKPKMRELL       120
     ATIVGDVQSG IPLSDSLKPH RQYFDDLYVD LVAAGEHSGS LDAVFDRIAT YREKAEALKS       180
     KIKKAMFYPA AVVVVAIAVT ALLLLFVVPQ FEEIFQGFGA ELPAFTQMIV DISRWLQASW       240
     YIFVIAIIIA VFSFKRAHLH SQSFRNRVDE FVLKIPAIGD ILDKGAMARF ARTLSTTFAA       300
     GVPLIDGLES SAGASGNYVY RSALLKVRQE VMAGMQMNVA MRTTGLFPDM LIQMVMIGEE       360
     SGGLDEMLNK VANIYEMQVD DAVDGLSSLI EPIMMVVIGT LVGGLIVGMY LPIFQMGNVV       420
     G                                                                       421
//

If you have problems or comments...

PBIL Back to PBIL home page