(data stored in ACNUC7421 zone)

EMBL: CP000821.PE426

CP000821.PE426       Location/Qualifiers
FT   CDS             complement(518556..518966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0426"
FT                   /product="methylation site containing protein"
FT                   /note="KEGG: sfr:Sfri_3782 methylation site containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35039"
FT                   /db_xref="GOA:A8FQB6"
FT                   /db_xref="InterPro:IPR001082"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQB6"
FT                   /protein_id="ABV35039.1"
FT                   /translation="MKGLNLNKSMKNAKGFTLIELMIVVAIIGILAAIALPAYKDYVAK
FT                   ADASAGVGTLAGSKTKVSEVYSIDGSIGCTDSNGDGIPYCAAADGILATQNEAGTVIIT
FT                   LTPDIASTPGSIEWGCVLSGANAVAIKGCTAP"
     MKGLNLNKSM KNAKGFTLIE LMIVVAIIGI LAAIALPAYK DYVAKADASA GVGTLAGSKT        60
     KVSEVYSIDG SIGCTDSNGD GIPYCAAADG ILATQNEAGT VIITLTPDIA STPGSIEWGC       120
     VLSGANAVAI KGCTAP                                                       136
//

If you have problems or comments...

PBIL Back to PBIL home page