(data stored in ACNUC7421 zone)

EMBL: CP000821.PE430

CP000821.PE430       Location/Qualifiers
FT   CDS             522956..523708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0430"
FT                   /product="regulatory protein GntR, HTH"
FT                   /note="KEGG: shn:Shewana3_0425 regulatory protein GntR,
FT                   HTH"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35043"
FT                   /db_xref="GOA:A8FQC0"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQC0"
FT                   /protein_id="ABV35043.1"
FT                   /translation="MAYSKINQPKISDVIMGQLEQMILEGSLQPGQKLPPERELALQFE
FT                   VSRPSLREAIQKLEAKGLLLRRQGGGTYVKEQLWQSLADPIVELMHSDSESQYDLLEFR
FT                   HATEGMMAYFAALRGTDADMQNIKRTIMEVDAASEIEQQAEAIVKFYRAVAEASHNVAM
FT                   LHLVLSLAPVLHKNVAQNLELLNRREEASKMANDHRLALLAAIVRRDPEAAREASNEHL
FT                   SYIEEVMLSVREEDSRLQRSLRRLKSGV"
     MAYSKINQPK ISDVIMGQLE QMILEGSLQP GQKLPPEREL ALQFEVSRPS LREAIQKLEA        60
     KGLLLRRQGG GTYVKEQLWQ SLADPIVELM HSDSESQYDL LEFRHATEGM MAYFAALRGT       120
     DADMQNIKRT IMEVDAASEI EQQAEAIVKF YRAVAEASHN VAMLHLVLSL APVLHKNVAQ       180
     NLELLNRREE ASKMANDHRL ALLAAIVRRD PEAAREASNE HLSYIEEVML SVREEDSRLQ       240
     RSLRRLKSGV                                                              250
//

If you have problems or comments...

PBIL Back to PBIL home page