(data stored in ACNUC7421 zone)

EMBL: CP000821.PE431

CP000821.PE431       Location/Qualifiers
FT   CDS             523795..526461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0431"
FT                   /product="Pyruvate dehydrogenase (acetyl-transferring)"
FT                   /EC_number="1.2.4.1"
FT                   /note="KEGG: slo:Shew_3431 2-oxo-acid dehydrogenase E1
FT                   subunit, homodimeric type"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35044"
FT                   /db_xref="GOA:A8FQC1"
FT                   /db_xref="InterPro:IPR004660"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR035807"
FT                   /db_xref="InterPro:IPR041621"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQC1"
FT                   /protein_id="ABV35044.1"
FT                   /translation="MSEHMLQDLDPLETQEWVDSLQAVLEQEGPERAHYLLEKLIDKAR
FT                   RNGTHLPYKATTAYLNTIPAGQEPHVPGNQEMERRIRAIVRWNALAMVLRGSKKDLELG
FT                   GHISSFASSATIYDVCFNHFFRGPNEKDGGDLVYFQGHIAPGIYSRSFLEGRLTEDQMN
FT                   SFRQEVDGKGLPSYPHPKLMPDYWQFPTVSMGLGPIQAIYQARFLKYLTDRGLKDCSEQ
FT                   TVYCFLGDGECDEPETLGAIGLAAREELDNLVFIVNCNLQRLDGPVRGNGKIIQELEGE
FT                   FRGAGWEAVKVIWGRYWDPLLARDTSGKLLQLMEETVDGEYQNCKAKGGAYTREHFFGK
FT                   YPETAEMVANMSDDDIWRLNRGGHDPVKIFAALQHAKDTKGRPTVILAKTVKGYGMGDA
FT                   GEGKNIAHNVKKMGVESLKYFRDRFNIPISDDQLEDIPFYHPGADSEEVKYLKARRAEL
FT                   HGAMPARREKFSEELEVPSLKIFDSVLKGSNGREISSTMAFVRILTALLKDKKIGKQIV
FT                   PIIPDEARTFGMEGLFRQVGIYAHEGQKYVPQDSDQVAYYREDKSGQVLQEGINELGAM
FT                   SSWVAAATSYSVNDTPMIPFYIYYSMFGFQRIGDMAWAAGDMRARGFMVGGTSGRTTLN
FT                   GEGLQHQDGHSHVLANTIPSCVSYDPTYGYEIAVVVQDGIRRMYGEQQEDIFYYLTTMN
FT                   ENYEQPAMPEGAEEGIVKGIYKLETVEGSGKGKVQLMGCGTILEQVRKAAQALAKDFGI
FT                   SADVFSVTSFNELTRDGQAAERYNMLHPTETPQEAYISQVISSESPAIVATDYMKIYGE
FT                   QLRAYIPTDYKVLGTDGFGRSDSRENLRHHFEVDAKFIVIASLKSLVDRNELPVDVLTK
FT                   AISEYGIDVDKINPQYA"
     MSEHMLQDLD PLETQEWVDS LQAVLEQEGP ERAHYLLEKL IDKARRNGTH LPYKATTAYL        60
     NTIPAGQEPH VPGNQEMERR IRAIVRWNAL AMVLRGSKKD LELGGHISSF ASSATIYDVC       120
     FNHFFRGPNE KDGGDLVYFQ GHIAPGIYSR SFLEGRLTED QMNSFRQEVD GKGLPSYPHP       180
     KLMPDYWQFP TVSMGLGPIQ AIYQARFLKY LTDRGLKDCS EQTVYCFLGD GECDEPETLG       240
     AIGLAAREEL DNLVFIVNCN LQRLDGPVRG NGKIIQELEG EFRGAGWEAV KVIWGRYWDP       300
     LLARDTSGKL LQLMEETVDG EYQNCKAKGG AYTREHFFGK YPETAEMVAN MSDDDIWRLN       360
     RGGHDPVKIF AALQHAKDTK GRPTVILAKT VKGYGMGDAG EGKNIAHNVK KMGVESLKYF       420
     RDRFNIPISD DQLEDIPFYH PGADSEEVKY LKARRAELHG AMPARREKFS EELEVPSLKI       480
     FDSVLKGSNG REISSTMAFV RILTALLKDK KIGKQIVPII PDEARTFGME GLFRQVGIYA       540
     HEGQKYVPQD SDQVAYYRED KSGQVLQEGI NELGAMSSWV AAATSYSVND TPMIPFYIYY       600
     SMFGFQRIGD MAWAAGDMRA RGFMVGGTSG RTTLNGEGLQ HQDGHSHVLA NTIPSCVSYD       660
     PTYGYEIAVV VQDGIRRMYG EQQEDIFYYL TTMNENYEQP AMPEGAEEGI VKGIYKLETV       720
     EGSGKGKVQL MGCGTILEQV RKAAQALAKD FGISADVFSV TSFNELTRDG QAAERYNMLH       780
     PTETPQEAYI SQVISSESPA IVATDYMKIY GEQLRAYIPT DYKVLGTDGF GRSDSRENLR       840
     HHFEVDAKFI VIASLKSLVD RNELPVDVLT KAISEYGIDV DKINPQYA                    888
//

If you have problems or comments...

PBIL Back to PBIL home page