(data stored in ACNUC7421 zone)

EMBL: CP000821.PE432

CP000821.PE432       Location/Qualifiers
FT   CDS             526474..528111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0432"
FT                   /product="Dihydrolipoyllysine-residue succinyltransferase"
FT                   /EC_number="2.3.1.61"
FT                   /note="KEGG: slo:Shew_3430 pyruvate dehydrogenase complex
FT                   dihydrolipoamide acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35045"
FT                   /db_xref="GOA:A8FQC2"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR006256"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQC2"
FT                   /protein_id="ABV35045.1"
FT                   /translation="MSELKEVLVPDIGGDDVQVIEICVAVGDQLAAEESIITVESDKAT
FT                   MDIPAPFAGTLAELKIAVGDTVSEGTLIAMMSAQGASTEVTAATAAPEPTPVAPAAPVD
FT                   AAPVPASTATQVIEVKVPDIGDAADVEIIEVLVAVGDSIDVDTGLITLETDKATMEVPA
FT                   PSAGVVKELKVAVGDKVSEGSLVLMLEVGASAPAAIVAPVEAPVVAPVAQPAQAATSKP
FT                   PVPHHPSAGSKPVTGAVHASPAVRRLAREFGADMTLVKGTGRKGRILKEDVQAFIKYEL
FT                   SRPKASAATAVAGGAGGLNVIAAPKVDFAKFGEIEEVPLTRIQKISGPNLHRNWVTIPH
FT                   VTQFDEADITEMEAFRKQQNELAAKRKTGIKITPLVFMMKAVAKTLQAFPVFNASLSAD
FT                   GESLIKKKYYHIGVAVDTPNGLVVPVVRDVDKKGIHELTQELTEISIKARDGKLKSADM
FT                   QGSCFTISSLGGIGGTAFTPIVNYPDVAILGVSKSEIKPKWNGKDFEPKLMLPLSLSYD
FT                   HRVIDGAMAARFSVTLSSMLSDIRTLIL"
     MSELKEVLVP DIGGDDVQVI EICVAVGDQL AAEESIITVE SDKATMDIPA PFAGTLAELK        60
     IAVGDTVSEG TLIAMMSAQG ASTEVTAATA APEPTPVAPA APVDAAPVPA STATQVIEVK       120
     VPDIGDAADV EIIEVLVAVG DSIDVDTGLI TLETDKATME VPAPSAGVVK ELKVAVGDKV       180
     SEGSLVLMLE VGASAPAAIV APVEAPVVAP VAQPAQAATS KPPVPHHPSA GSKPVTGAVH       240
     ASPAVRRLAR EFGADMTLVK GTGRKGRILK EDVQAFIKYE LSRPKASAAT AVAGGAGGLN       300
     VIAAPKVDFA KFGEIEEVPL TRIQKISGPN LHRNWVTIPH VTQFDEADIT EMEAFRKQQN       360
     ELAAKRKTGI KITPLVFMMK AVAKTLQAFP VFNASLSADG ESLIKKKYYH IGVAVDTPNG       420
     LVVPVVRDVD KKGIHELTQE LTEISIKARD GKLKSADMQG SCFTISSLGG IGGTAFTPIV       480
     NYPDVAILGV SKSEIKPKWN GKDFEPKLML PLSLSYDHRV IDGAMAARFS VTLSSMLSDI       540
     RTLIL                                                                   545
//

If you have problems or comments...

PBIL Back to PBIL home page