(data stored in ACNUC7421 zone)

EMBL: CP000821.PE436

CP000821.PE436       Location/Qualifiers
FT   CDS             536775..538829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0436"
FT                   /product="Endothelin-converting enzyme 1"
FT                   /EC_number="3.4.24.71"
FT                   /note="KEGG: slo:Shew_3426 endothelin-converting enzyme 1"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35049"
FT                   /db_xref="GOA:A8FQC6"
FT                   /db_xref="InterPro:IPR000718"
FT                   /db_xref="InterPro:IPR008753"
FT                   /db_xref="InterPro:IPR018497"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="InterPro:IPR042089"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQC6"
FT                   /protein_id="ABV35049.1"
FT                   /translation="MNRVSKLAIGIALSLGLAACSSNEPTTTVAEEVTKVSGVEQENFD
FT                   NAVRHQDDFYYSVNGHWLANTPIPADKSNYGAFSVLYEQSQNALKKIIDEAAAKQDKVA
FT                   GSSEQKVGDFYASYMNTDVIEKLGISPLSDLLSDISSAKTHKDIAGLMGSLLNSGVQMP
FT                   FGFYVNNDAKNSSQYAVYLYQSGLTLPDRDYYLKDDEKFVANRAALNAYVADIMAQAGS
FT                   QDAERVAASVAKIEHFIAQSQWSRVESRDANKSYNMMDSAELQATVSSFDFAQFAANAN
FT                   MSSVKEAVVRQPSYFEKFGAQFNEFTVSEWQDYLSFHLVDSYGELLSKNFVDLHFAFHS
FT                   KTLMGIEAQKPRWKKAVDAADQVIGELVGKEYVKQHFKPEAKEKMEELIQNLIKGFEVS
FT                   INELEWMTPETKIAAQEKLSKFTYKIGYPDKWKDYTDLSIKADQLVGNIQRYSKFEYKT
FT                   MLNKLGKPIDRTEWHMTPQTVNAYYSPVMNEIVFPAAILQPPFFNMDADDAINYGGIGA
FT                   VIGHEISHGFDDQGAKYDGDGNLRDWWTDKDREEFQKRGAQLSAQYSSYEALPGKHVNG
FT                   DLTLGENIGDLGGLTVAARSYHLSLNGKESPVIEGLTGEQRLFIGWSQVWRRNYRDEEL
FT                   GRRLMTDSHSPSHFRAMGTPRNIPAFYQAFDLKEGDKMFLSPEDRVKIW"
     MNRVSKLAIG IALSLGLAAC SSNEPTTTVA EEVTKVSGVE QENFDNAVRH QDDFYYSVNG        60
     HWLANTPIPA DKSNYGAFSV LYEQSQNALK KIIDEAAAKQ DKVAGSSEQK VGDFYASYMN       120
     TDVIEKLGIS PLSDLLSDIS SAKTHKDIAG LMGSLLNSGV QMPFGFYVNN DAKNSSQYAV       180
     YLYQSGLTLP DRDYYLKDDE KFVANRAALN AYVADIMAQA GSQDAERVAA SVAKIEHFIA       240
     QSQWSRVESR DANKSYNMMD SAELQATVSS FDFAQFAANA NMSSVKEAVV RQPSYFEKFG       300
     AQFNEFTVSE WQDYLSFHLV DSYGELLSKN FVDLHFAFHS KTLMGIEAQK PRWKKAVDAA       360
     DQVIGELVGK EYVKQHFKPE AKEKMEELIQ NLIKGFEVSI NELEWMTPET KIAAQEKLSK       420
     FTYKIGYPDK WKDYTDLSIK ADQLVGNIQR YSKFEYKTML NKLGKPIDRT EWHMTPQTVN       480
     AYYSPVMNEI VFPAAILQPP FFNMDADDAI NYGGIGAVIG HEISHGFDDQ GAKYDGDGNL       540
     RDWWTDKDRE EFQKRGAQLS AQYSSYEALP GKHVNGDLTL GENIGDLGGL TVAARSYHLS       600
     LNGKESPVIE GLTGEQRLFI GWSQVWRRNY RDEELGRRLM TDSHSPSHFR AMGTPRNIPA       660
     FYQAFDLKEG DKMFLSPEDR VKIW                                              684
//

If you have problems or comments...

PBIL Back to PBIL home page