(data stored in ACNUC7421 zone)

EMBL: CP000821.PE44

CP000821.PE44        Location/Qualifiers
FT   CDS             50517..50795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0044"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: vpa:VP3032 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34657"
FT                   /db_xref="InterPro:IPR009962"
FT                   /db_xref="InterPro:IPR036692"
FT                   /db_xref="UniProtKB/TrEMBL:A8FP84"
FT                   /protein_id="ABV34657.1"
FT                   /translation="MNQNILFPDLQDWDEKTQSVVFPAQVQGANIECRIGLSKLSEMAL
FT                   TLLKSTDSDIKEKALNLFEEYRFDIEEEVETLIELESFDEQGRLVVK"
     MNQNILFPDL QDWDEKTQSV VFPAQVQGAN IECRIGLSKL SEMALTLLKS TDSDIKEKAL        60
     NLFEEYRFDI EEEVETLIEL ESFDEQGRLV VK                                      92
//

If you have problems or comments...

PBIL Back to PBIL home page