(data stored in ACNUC7421 zone)

EMBL: CP000821.PE441

CP000821.PE441       Location/Qualifiers
FT   CDS             545598..548210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0441"
FT                   /product="sensory box protein"
FT                   /note="KEGG: son:SO0437 sensory box protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35054"
FT                   /db_xref="GOA:A8FQD1"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQD1"
FT                   /protein_id="ABV35054.1"
FT                   /translation="MRIGKKLIVFIVGFCLPAVISVSYCLSMWFDHRVDTFKNSAVNIE
FT                   LSTIKTQIEKDINQLQLLANVYALPLSKLAIEERKLLDEAWRDSQLAEHLSLFYLNNGE
FT                   LQPFSPIYDDIMSFEFDTVPVQLKHATQPLSGIYMLQDKSFIVSLVPVSQSRSIILARQ
FT                   LTPEYLSSYGLKGLVSHINLVPGESSLVYDVNSDKPISSIKVPSLVFESPVHLEIQFAE
FT                   NAFNQVKLKYDLVTFSIVGVGLLILIIGYIWLKLGLIRPFRRLMTQVADIDPIAKTYTP
FT                   LVGSGCSELVIMAERVNTLLARIFQQKERFKTTLESIAEAVILTDIGAKVVYLNPQAER
FT                   LLGVKGESAIGVSVDSLVKTDKSIKDDLFEFMFSQAQQPVLSKLKLKTDKTRILERSIS
FT                   NLLNQQRIVIGTVIVLRDITREELLKRQLRQKANFDSITSLLNRRAFEERLEKFSHDAQ
FT                   SIAICYFDLEQFKLINDSCGHSAGDTMLAMVAKAMQSCLSKDEMLARLGGDEFGLAIRD
FT                   HNASEVAQLVKRIVSSVSMQVLRDNGCHYKVGVSAGVAIARAPYISPKELIKDADVACI
FT                   AAKRKGSNQVHFYDDNDKESIYQRNAPMWAVRIGQAIEHNELLLYYQPIKGMGPGEHKQ
FT                   RMEILLRIQEPCGRILSPAQFIEAAERFKLMNDVDKEVIRKAFLWLSLHEEIWDDHCIS
FT                   INLSGNSLGAEGMVEYIAEQFKRFEIPSKCICFEITETSAIQNRNRAMDMLNYLRKLGF
FT                   SFALDDFGTGFASYGYLKELPVDYVKIDGCFVKSLATNAKDFAIVKSIHDVCDVMGIET
FT                   VAEFVENQDIIDRLEDIGINYAQGYAIGRPKPLETYIELRRSRGQPLQAKPALELISA"
     MRIGKKLIVF IVGFCLPAVI SVSYCLSMWF DHRVDTFKNS AVNIELSTIK TQIEKDINQL        60
     QLLANVYALP LSKLAIEERK LLDEAWRDSQ LAEHLSLFYL NNGELQPFSP IYDDIMSFEF       120
     DTVPVQLKHA TQPLSGIYML QDKSFIVSLV PVSQSRSIIL ARQLTPEYLS SYGLKGLVSH       180
     INLVPGESSL VYDVNSDKPI SSIKVPSLVF ESPVHLEIQF AENAFNQVKL KYDLVTFSIV       240
     GVGLLILIIG YIWLKLGLIR PFRRLMTQVA DIDPIAKTYT PLVGSGCSEL VIMAERVNTL       300
     LARIFQQKER FKTTLESIAE AVILTDIGAK VVYLNPQAER LLGVKGESAI GVSVDSLVKT       360
     DKSIKDDLFE FMFSQAQQPV LSKLKLKTDK TRILERSISN LLNQQRIVIG TVIVLRDITR       420
     EELLKRQLRQ KANFDSITSL LNRRAFEERL EKFSHDAQSI AICYFDLEQF KLINDSCGHS       480
     AGDTMLAMVA KAMQSCLSKD EMLARLGGDE FGLAIRDHNA SEVAQLVKRI VSSVSMQVLR       540
     DNGCHYKVGV SAGVAIARAP YISPKELIKD ADVACIAAKR KGSNQVHFYD DNDKESIYQR       600
     NAPMWAVRIG QAIEHNELLL YYQPIKGMGP GEHKQRMEIL LRIQEPCGRI LSPAQFIEAA       660
     ERFKLMNDVD KEVIRKAFLW LSLHEEIWDD HCISINLSGN SLGAEGMVEY IAEQFKRFEI       720
     PSKCICFEIT ETSAIQNRNR AMDMLNYLRK LGFSFALDDF GTGFASYGYL KELPVDYVKI       780
     DGCFVKSLAT NAKDFAIVKS IHDVCDVMGI ETVAEFVENQ DIIDRLEDIG INYAQGYAIG       840
     RPKPLETYIE LRRSRGQPLQ AKPALELISA                                        870
//

If you have problems or comments...

PBIL Back to PBIL home page