(data stored in ACNUC7421 zone)

EMBL: CP000821.PE442

CP000821.PE442       Location/Qualifiers
FT   CDS             complement(548378..551380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0442"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_3414 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35055"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQD2"
FT                   /protein_id="ABV35055.1"
FT                   /translation="MRYLLLMITFLITACGGGGDDDTTTPTQEKLTHPGLSALDIRVDY
FT                   SPDGSLTPVLSGSQGNISFSLADGAANDVVRVNQNSLTILNVGQTKLIVTDSGNSQYKA
FT                   TSRSLNVSVDRASRDPLLTNNYSYPYAAGAIHQVGVSGAKGQLLYELSTGYPDDVVKID
FT                   IAGSLIVWGEGQTQVTVKDDGGRNYQASESQFSITVEAANSQFASYRDITNKPLVFGGT
FT                   LLPVYSGSPTSEISYAIAENASQDVVQIHPITGVMNIKGAGETEIVVSQTAEDNHQDIA
FT                   KQTFKVRINKADNTDFIANDLTLPYGFDDEPRLQTIGAQGTLTFEIVDGESTDVINFIN
FT                   SETGQYRFSGIGETKVKITDSGNRNYLSKTVITTVNVERVQSVPLSSVNLESAYQQNKV
FT                   ISAQVASRQGKLSFSLAKDSATDVVSIDALSGEMTVLKPGKAEITVTDDGDLFYIPQTT
FT                   SFFVTINKLVNDQFSVDDDLYDNVANTVYTPVAKGSQGPVTYAISANSTANVLSQDPTT
FT                   KVITLTGAGRGWITATDHGNDYYQSQTTDFIVDVGYADGTLKPLAISAGYAPNKVVTIP
FT                   VSGVVGQLSSQLERGQPDDVVNIDIVNRTVTIKNAGTTYYTLTDSGSAAIAPRRVQLRV
FT                   TIAKAAANVDLSLTSTLIDTIYEEGKQLSSPAVSGSATESTIKYYVDYSDRQVVTADSS
FT                   SGALTIKGAGSAQVQVTEVSRNFEDTTRSFTVNVGKAKHPGLTVAKQVPGASYYPGLEM
FT                   APAELGNQFGELSFKFTHTEKPETYELTRNGTLRVLKYAASRTNTSVRITVTDDGGDDY
FT                   LPSSVDYDVYVNPIEEGTGEKSVFTFDGTELSITSPIDVAAGDVTYFSASDTRSEAETM
FT                   GDNLQKSGGYATQRVTVCHDPSVLTTCTLVTVRLQNTSHCPDGSKIAYPVGAKIRYECP
FT                   GLKQPINSEVMVSFDKTDLFNPSLAVGTYQALEPITLVHFAKPYRAGGVIEMGDIQARA
FT                   WWLIKVNLTVN"
     MRYLLLMITF LITACGGGGD DDTTTPTQEK LTHPGLSALD IRVDYSPDGS LTPVLSGSQG        60
     NISFSLADGA ANDVVRVNQN SLTILNVGQT KLIVTDSGNS QYKATSRSLN VSVDRASRDP       120
     LLTNNYSYPY AAGAIHQVGV SGAKGQLLYE LSTGYPDDVV KIDIAGSLIV WGEGQTQVTV       180
     KDDGGRNYQA SESQFSITVE AANSQFASYR DITNKPLVFG GTLLPVYSGS PTSEISYAIA       240
     ENASQDVVQI HPITGVMNIK GAGETEIVVS QTAEDNHQDI AKQTFKVRIN KADNTDFIAN       300
     DLTLPYGFDD EPRLQTIGAQ GTLTFEIVDG ESTDVINFIN SETGQYRFSG IGETKVKITD       360
     SGNRNYLSKT VITTVNVERV QSVPLSSVNL ESAYQQNKVI SAQVASRQGK LSFSLAKDSA       420
     TDVVSIDALS GEMTVLKPGK AEITVTDDGD LFYIPQTTSF FVTINKLVND QFSVDDDLYD       480
     NVANTVYTPV AKGSQGPVTY AISANSTANV LSQDPTTKVI TLTGAGRGWI TATDHGNDYY       540
     QSQTTDFIVD VGYADGTLKP LAISAGYAPN KVVTIPVSGV VGQLSSQLER GQPDDVVNID       600
     IVNRTVTIKN AGTTYYTLTD SGSAAIAPRR VQLRVTIAKA AANVDLSLTS TLIDTIYEEG       660
     KQLSSPAVSG SATESTIKYY VDYSDRQVVT ADSSSGALTI KGAGSAQVQV TEVSRNFEDT       720
     TRSFTVNVGK AKHPGLTVAK QVPGASYYPG LEMAPAELGN QFGELSFKFT HTEKPETYEL       780
     TRNGTLRVLK YAASRTNTSV RITVTDDGGD DYLPSSVDYD VYVNPIEEGT GEKSVFTFDG       840
     TELSITSPID VAAGDVTYFS ASDTRSEAET MGDNLQKSGG YATQRVTVCH DPSVLTTCTL       900
     VTVRLQNTSH CPDGSKIAYP VGAKIRYECP GLKQPINSEV MVSFDKTDLF NPSLAVGTYQ       960
     ALEPITLVHF AKPYRAGGVI EMGDIQARAW WLIKVNLTVN                            1000
//

If you have problems or comments...

PBIL Back to PBIL home page