(data stored in ACNUC7421 zone)

EMBL: CP000821.PE447

CP000821.PE447       Location/Qualifiers
FT   CDS             557633..559471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0447"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: saz:Sama_2990 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35060"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="InterPro:IPR038266"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQD7"
FT                   /protein_id="ABV35060.1"
FT                   /translation="MKVLNKRYLALVVAGAMGLSACGSDGKDGEDGTTPPPPTVGGSQV
FT                   TNVEMLSHTLEEGLVRFEFEITNEEGVLITGLEEASAEVAALTEKGIQRSRDGSVGGSA
FT                   NVSTEGASLTMTQDGRYEFIAPMAAVNAGTEGLIRLAVGGGDNIAKSRYIVVDKTENIH
FT                   TTSTATCQSCHVDFLASSIKHSSYTAINAEGETDLVAGCMACHNHVPRDVDDSGSSLNT
FT                   GGYAKNSLQKIGHINHQKFEKDFAPSNCYTCHAEPIETVYSQQTCIDCHDTANVETSNL
FT                   AATFNSFNEGSDMRLFHKKIAEKKAVHEEHSLATSQVYNNELGEFCTDISLFKGEEQLD
FT                   LEGLTSDGTISYIGAYLHGYENASIVGRAARSYSATFDAAGSATLCFSSLDELFPEIIA
FT                   SSRVTFNFGEDAGYDGVTLHGYSDALSGTEYARRHSVTADSCTTCHTNGSNYHKNGSYN
FT                   DGGLGCVACHNNGQDRNAKSSAPGFGPMVHSMHWGVGNTATDPDGEANSAAKLNAENCV
FT                   ACHAEGIDIDAIPNQYILSKAYNGGESGVMTSPVTANCFACHNDDSAKNHMLQQGGEIN
FT                   VEKLEDWYTLPTSESCSTCHAEGKSYGIEKFHVFER"
     MKVLNKRYLA LVVAGAMGLS ACGSDGKDGE DGTTPPPPTV GGSQVTNVEM LSHTLEEGLV        60
     RFEFEITNEE GVLITGLEEA SAEVAALTEK GIQRSRDGSV GGSANVSTEG ASLTMTQDGR       120
     YEFIAPMAAV NAGTEGLIRL AVGGGDNIAK SRYIVVDKTE NIHTTSTATC QSCHVDFLAS       180
     SIKHSSYTAI NAEGETDLVA GCMACHNHVP RDVDDSGSSL NTGGYAKNSL QKIGHINHQK       240
     FEKDFAPSNC YTCHAEPIET VYSQQTCIDC HDTANVETSN LAATFNSFNE GSDMRLFHKK       300
     IAEKKAVHEE HSLATSQVYN NELGEFCTDI SLFKGEEQLD LEGLTSDGTI SYIGAYLHGY       360
     ENASIVGRAA RSYSATFDAA GSATLCFSSL DELFPEIIAS SRVTFNFGED AGYDGVTLHG       420
     YSDALSGTEY ARRHSVTADS CTTCHTNGSN YHKNGSYNDG GLGCVACHNN GQDRNAKSSA       480
     PGFGPMVHSM HWGVGNTATD PDGEANSAAK LNAENCVACH AEGIDIDAIP NQYILSKAYN       540
     GGESGVMTSP VTANCFACHN DDSAKNHMLQ QGGEINVEKL EDWYTLPTSE SCSTCHAEGK       600
     SYGIEKFHVF ER                                                           612
//

If you have problems or comments...

PBIL Back to PBIL home page