(data stored in ACNUC7421 zone)

EMBL: CP000821.PE450

CP000821.PE450       Location/Qualifiers
FT   CDS             complement(563331..564059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0450"
FT                   /product="protein of unknown function DUF28"
FT                   /note="KEGG: slo:Shew_3408 protein of unknown function
FT                   DUF28"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35063"
FT                   /db_xref="GOA:A8FQE0"
FT                   /db_xref="InterPro:IPR002876"
FT                   /db_xref="InterPro:IPR017856"
FT                   /db_xref="InterPro:IPR026564"
FT                   /db_xref="InterPro:IPR029072"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQE0"
FT                   /protein_id="ABV35063.1"
FT                   /translation="MGRAYQNKKESMAKTAGQKTRIYSRYGKELYVCAKNGGFDPDGNL
FT                   PLRQLIAKAKKDQVPAHVIERAIEKAKGGGGEDYETARYEGFGPGGCMVIVDCLTDNGK
FT                   RTFTEVRQAFVKNDAKLGGPGTVGHMFEHQAIFVFAGEDEEEVLEMLMMADVDVTDVEV
FT                   EDGMISVYAPNTEFYKTKTALNEAMPEVEFVVEEITFVPQTMTDISDPEVIEQLEKFLA
FT                   ALEDCDDVQNVYHNAEFAEN"
     MGRAYQNKKE SMAKTAGQKT RIYSRYGKEL YVCAKNGGFD PDGNLPLRQL IAKAKKDQVP        60
     AHVIERAIEK AKGGGGEDYE TARYEGFGPG GCMVIVDCLT DNGKRTFTEV RQAFVKNDAK       120
     LGGPGTVGHM FEHQAIFVFA GEDEEEVLEM LMMADVDVTD VEVEDGMISV YAPNTEFYKT       180
     KTALNEAMPE VEFVVEEITF VPQTMTDISD PEVIEQLEKF LAALEDCDDV QNVYHNAEFA       240
     EN                                                                      242
//

If you have problems or comments...

PBIL Back to PBIL home page