(data stored in ACNUC7421 zone)

EMBL: CP000821.PE452

CP000821.PE452       Location/Qualifiers
FT   CDS             565201..566259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0452"
FT                   /product="secretion protein HlyD family protein"
FT                   /note="KEGG: shm:Shewmr7_3509 secretion protein HlyD family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35065"
FT                   /db_xref="GOA:A8FQE2"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQE2"
FT                   /protein_id="ABV35065.1"
FT                   /translation="MSKSKLFIAVPLIFAALAGGAYYWWTQVRFFESTDNAYVEADISH
FT                   ISVKVPGYVVMTDITDNQHVNAGQLLAQLEDNQYEAKLAQSQAELDSSQAELQTLSAKV
FT                   ELQHALIAQAQAGVAAAGSDRLRSEQQLRRSKKLKEKNYSSQDDVDQMQASFESSVAHL
FT                   DEANAALVAKQRELAVFNAQLLQADANVVKAKAGLELAKIQLADTQVRAPFSGVIGKRG
FT                   ALKGQYVQPGQALYSLVPDGAVWITANFKETQIQHMQPGQSVQVNLDAFPDKTFTGVID
FT                   SLSPASGAKFSLLPAENATGNFTKIVQRIPVRIRLELGEERERLVPGLSAIVKVDTTTL
FT                   SLDSALAANIGH"
     MSKSKLFIAV PLIFAALAGG AYYWWTQVRF FESTDNAYVE ADISHISVKV PGYVVMTDIT        60
     DNQHVNAGQL LAQLEDNQYE AKLAQSQAEL DSSQAELQTL SAKVELQHAL IAQAQAGVAA       120
     AGSDRLRSEQ QLRRSKKLKE KNYSSQDDVD QMQASFESSV AHLDEANAAL VAKQRELAVF       180
     NAQLLQADAN VVKAKAGLEL AKIQLADTQV RAPFSGVIGK RGALKGQYVQ PGQALYSLVP       240
     DGAVWITANF KETQIQHMQP GQSVQVNLDA FPDKTFTGVI DSLSPASGAK FSLLPAENAT       300
     GNFTKIVQRI PVRIRLELGE ERERLVPGLS AIVKVDTTTL SLDSALAANI GH               352
//

If you have problems or comments...

PBIL Back to PBIL home page