(data stored in ACNUC7421 zone)

EMBL: CP000821.PE456

CP000821.PE456       Location/Qualifiers
FT   CDS             569096..570025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0456"
FT                   /product="radical SAM domain protein"
FT                   /note="KEGG: shm:Shewmr7_3501 radical SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35069"
FT                   /db_xref="GOA:A8FQE6"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQE6"
FT                   /protein_id="ABV35069.1"
FT                   /translation="MHDADYCLFFSRECQPLNYIEPLFRPPSEWKSLILQVTNGCSWNR
FT                   CTFCDMYTAPQKRFRAQKLDKIAADIIAVAETGRSVHRVFLADGDAMSLPFDRLEAICL
FT                   LIREHLPDVTRISSYCLPRNLKNKTSEELSRLKALGLSLLYIGCESGDDEVLRRIEKGE
FT                   SFDSSLAALKKIKAAGIKSSVMILNGLGGTELSTQHAINSAKLMNASQPEYLSTLVVTL
FT                   PLGTERMDASFDGHFQLPDQHGLFVEMHTLLKHLELDKTIFRSDHASNYLVLKGTLGKD
FT                   KEKLIAQVEQAMTKPQSSGLRQEWQRGL"
     MHDADYCLFF SRECQPLNYI EPLFRPPSEW KSLILQVTNG CSWNRCTFCD MYTAPQKRFR        60
     AQKLDKIAAD IIAVAETGRS VHRVFLADGD AMSLPFDRLE AICLLIREHL PDVTRISSYC       120
     LPRNLKNKTS EELSRLKALG LSLLYIGCES GDDEVLRRIE KGESFDSSLA ALKKIKAAGI       180
     KSSVMILNGL GGTELSTQHA INSAKLMNAS QPEYLSTLVV TLPLGTERMD ASFDGHFQLP       240
     DQHGLFVEMH TLLKHLELDK TIFRSDHASN YLVLKGTLGK DKEKLIAQVE QAMTKPQSSG       300
     LRQEWQRGL                                                               309
//

If you have problems or comments...

PBIL Back to PBIL home page