(data stored in ACNUC7421 zone)

EMBL: CP000821.PE458

CP000821.PE458       Location/Qualifiers
FT   CDS             571153..571617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0458"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shw:Sputw3181_3632 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35071"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQE8"
FT                   /protein_id="ABV35071.1"
FT                   /translation="MRTLLFVICTLLTSFAQASSYAEGDLVSQIQLQDQFENEITVSEG
FT                   TQTLLFSRNMKGGDIIKEALEVLTAEQKQASDKLVYVADISGMPSLIAKFVAIPQMKDL
FT                   PFSMALDREGETTRLLPSEKDQATLIKLDHLKVMSVSTFDSSAALIKALR"
     MRTLLFVICT LLTSFAQASS YAEGDLVSQI QLQDQFENEI TVSEGTQTLL FSRNMKGGDI        60
     IKEALEVLTA EQKQASDKLV YVADISGMPS LIAKFVAIPQ MKDLPFSMAL DREGETTRLL       120
     PSEKDQATLI KLDHLKVMSV STFDSSAALI KALR                                   154
//

If you have problems or comments...

PBIL Back to PBIL home page