(data stored in ACNUC7421 zone)

EMBL: CP000821.PE459

CP000821.PE459       Location/Qualifiers
FT   CDS             complement(571698..571919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0459"
FT                   /product="protein of unknown function DUF465"
FT                   /note="KEGG: slo:Shew_3391 protein of unknown function
FT                   DUF465"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35072"
FT                   /db_xref="InterPro:IPR007420"
FT                   /db_xref="InterPro:IPR038444"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQE9"
FT                   /protein_id="ABV35072.1"
FT                   /translation="MFPEYRELITKLKSEDTHFLKKFNKHNALDDEIKELEQHSSSGFT
FT                   NEVHELKRKKLHLKEEIHTILKNTPQMI"
     MFPEYRELIT KLKSEDTHFL KKFNKHNALD DEIKELEQHS SSGFTNEVHE LKRKKLHLKE        60
     EIHTILKNTP QMI                                                           73
//

If you have problems or comments...

PBIL Back to PBIL home page