(data stored in ACNUC7421 zone)

EMBL: CP000821.PE460

CP000821.PE460       Location/Qualifiers
FT   CDS             571921..572160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35073"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQF0"
FT                   /protein_id="ABV35073.1"
FT                   /translation="MVISSFFFILFISKLARFVTAKCDSGQQLITRHKYLLEGKRLKCD
FT                   LWLSDGGKDNGRYNSLFFKATYTGTEPIYLDLCL"
     MVISSFFFIL FISKLARFVT AKCDSGQQLI TRHKYLLEGK RLKCDLWLSD GGKDNGRYNS        60
     LFFKATYTGT EPIYLDLCL                                                     79
//

If you have problems or comments...

PBIL Back to PBIL home page