(data stored in ACNUC7421 zone)

EMBL: CP000821.PE462

CP000821.PE462       Location/Qualifiers
FT   CDS             complement(573219..573971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0462"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_3389 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35075"
FT                   /db_xref="GOA:A8FQF2"
FT                   /db_xref="InterPro:IPR036777"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQF2"
FT                   /protein_id="ABV35075.1"
FT                   /translation="MNKKWLLLALFAAPQAMADDMIHWWDASVTALYGDNYDLAPSDKQ
FT                   TTFTFETAGAWQYGDWFAFQDLIYFNGSNVSSDSTTYGEISTRLSAGKISGKEIGFGPV
FT                   TDLSLAMTFEEGEGPVKSFLYGLGMDIAIPYFSYFQLNTYRREAISSGNISDGWQITPA
FT                   FRMDFPVGNSNIVFDGFFDWVFSADNQGYEENFHFNPQLKYDLGAVIFGSHEKNKFLVG
FT                   VEYDYWKNKYGVKGVDQNTYSVIAKYHF"
     MNKKWLLLAL FAAPQAMADD MIHWWDASVT ALYGDNYDLA PSDKQTTFTF ETAGAWQYGD        60
     WFAFQDLIYF NGSNVSSDST TYGEISTRLS AGKISGKEIG FGPVTDLSLA MTFEEGEGPV       120
     KSFLYGLGMD IAIPYFSYFQ LNTYRREAIS SGNISDGWQI TPAFRMDFPV GNSNIVFDGF       180
     FDWVFSADNQ GYEENFHFNP QLKYDLGAVI FGSHEKNKFL VGVEYDYWKN KYGVKGVDQN       240
     TYSVIAKYHF                                                              250
//

If you have problems or comments...

PBIL Back to PBIL home page