(data stored in ACNUC7421 zone)

EMBL: CP000821.PE463

CP000821.PE463       Location/Qualifiers
FT   CDS             574310..574783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0463"
FT                   /product="protein of unknown function DUF107"
FT                   /note="KEGG: shw:Sputw3181_3627 protein of unknown function
FT                   DUF107"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35076"
FT                   /db_xref="GOA:A8FQF3"
FT                   /db_xref="InterPro:IPR002810"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQF3"
FT                   /protein_id="ABV35076.1"
FT                   /translation="MELSNPIIIWGCIGLALMLAEIIIPGGIVILLGGACLVVASALAV
FT                   GLVEGIVQSLTLWFIVSIVFLLGFRQLTQKLVGGDSHVDNTDEELDIYNQTAVVKETIG
FT                   PAQHQGRIEFQGIEWSALGDGSEIAAGTRVRIICRDNIALVVEPCPDEVNMSN"
     MELSNPIIIW GCIGLALMLA EIIIPGGIVI LLGGACLVVA SALAVGLVEG IVQSLTLWFI        60
     VSIVFLLGFR QLTQKLVGGD SHVDNTDEEL DIYNQTAVVK ETIGPAQHQG RIEFQGIEWS       120
     ALGDGSEIAA GTRVRIICRD NIALVVEPCP DEVNMSN                                157
//

If you have problems or comments...

PBIL Back to PBIL home page