(data stored in ACNUC7421 zone)

EMBL: CP000821.PE464

CP000821.PE464       Location/Qualifiers
FT   CDS             574914..575861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0464"
FT                   /product="band 7 protein"
FT                   /note="KEGG: slo:Shew_3387 band 7 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35077"
FT                   /db_xref="GOA:A8FQF4"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR032435"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQF4"
FT                   /protein_id="ABV35077.1"
FT                   /translation="MFVFTIFVLFIFFILYKLLLIVPMREVNVIERLGKFRAVLKPGFH
FT                   FLIPFFDRVAYKHEIREQVLDVPPQSCISKDNTQLEVDGLVYLKVMDGKLASYGIENYR
FT                   LAAVNLAQTTMRSEIGKLSLSQTFSERDSLNESIVREIDKASDPWGIKVLRYEIKNITP
FT                   SRKVIHTLEKQMEAERSKRAEITLANAEKAAMINLSEGERQEAINISEGQKLKRINEAK
FT                   GTAQEISIIAKAKAEGMELVSTALALDGGHEAMNMQLKEQFIGQVGKILNEAEISVVPA
FT                   EMAKLEGFFEGMEQVTHAVSSSSTGSNSVKGGRS"
     MFVFTIFVLF IFFILYKLLL IVPMREVNVI ERLGKFRAVL KPGFHFLIPF FDRVAYKHEI        60
     REQVLDVPPQ SCISKDNTQL EVDGLVYLKV MDGKLASYGI ENYRLAAVNL AQTTMRSEIG       120
     KLSLSQTFSE RDSLNESIVR EIDKASDPWG IKVLRYEIKN ITPSRKVIHT LEKQMEAERS       180
     KRAEITLANA EKAAMINLSE GERQEAINIS EGQKLKRINE AKGTAQEISI IAKAKAEGME       240
     LVSTALALDG GHEAMNMQLK EQFIGQVGKI LNEAEISVVP AEMAKLEGFF EGMEQVTHAV       300
     SSSSTGSNSV KGGRS                                                        315
//

If you have problems or comments...

PBIL Back to PBIL home page