(data stored in ACNUC7421 zone)

EMBL: CP000821.PE465

CP000821.PE465       Location/Qualifiers
FT   CDS             575858..576793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0465"
FT                   /product="band 7 protein"
FT                   /note="KEGG: slo:Shew_3386 band 7 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35078"
FT                   /db_xref="GOA:A8FQF5"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQF5"
FT                   /protein_id="ABV35078.1"
FT                   /translation="MIAGINTDLIVLGIWGLIFALFIIKLFQSIRLVPTKSAYIVERLG
FT                   KYHSTLDAGFHALVPFVDKVSYIHDLKEETIDVPPQECFSSDEVNVEVDGVIYISVVDP
FT                   VKASYGVTDYRYAAIQLAQTTTRSVIGTLDLDRTFEERDVISAKVVEVLDQAGAMWGIR
FT                   VHRYEIKNITPPETVKNAMEMQVNAERERRALLAKSEGDKQSKINRSEGIKAEMINLSE
FT                   GEMQKRINEAEGKGEEILTIAKATAESIELMATVIAAPGGKNVVRMQLGAQYLKQLDGL
FT                   SNGASRVVLPGNMMDFDHWMDSIGLEESKS"
     MIAGINTDLI VLGIWGLIFA LFIIKLFQSI RLVPTKSAYI VERLGKYHST LDAGFHALVP        60
     FVDKVSYIHD LKEETIDVPP QECFSSDEVN VEVDGVIYIS VVDPVKASYG VTDYRYAAIQ       120
     LAQTTTRSVI GTLDLDRTFE ERDVISAKVV EVLDQAGAMW GIRVHRYEIK NITPPETVKN       180
     AMEMQVNAER ERRALLAKSE GDKQSKINRS EGIKAEMINL SEGEMQKRIN EAEGKGEEIL       240
     TIAKATAESI ELMATVIAAP GGKNVVRMQL GAQYLKQLDG LSNGASRVVL PGNMMDFDHW       300
     MDSIGLEESK S                                                            311
//

If you have problems or comments...

PBIL Back to PBIL home page