(data stored in ACNUC7421 zone)

EMBL: CP000821.PE469

CP000821.PE469       Location/Qualifiers
FT   CDS             581370..582482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0469"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shn:Shewana3_0475 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35082"
FT                   /db_xref="GOA:A8FQF9"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQF9"
FT                   /protein_id="ABV35082.1"
FT                   /translation="MRQVVKFRLIFLSVAILCYAAGFQFLPETLEISNGQEISIAFALL
FT                   YFAFLPLLYWLCIIKLGKQKLWKLLLIVSLSCLMARLSFPVEIASYFEFIIWLRFPIIA
FT                   ILLGIELFLIVSVIKALWQARNLSGDPRINILEQFGQEDDRKRSMALALAMEPASWFYA
FT                   IPRFSRKHPPSVTHINLLSASRWHWLLLACATVLLAGASYVVIQPWSEITAIIVSSFIL
FT                   YGLILITANYRVSRHFSVYRHGDQLIINNGVWGFSLVKFDQIHRVMVSPPPCENRTGVI
FT                   NFGQGESSNIILKFKHPQTYFGGLGWLPEEVKAIAMVVDKPEALADLIFDISDERELEV
FT                   RRAELTPSWKESISQEVFEGNADMPTELTS"
     MRQVVKFRLI FLSVAILCYA AGFQFLPETL EISNGQEISI AFALLYFAFL PLLYWLCIIK        60
     LGKQKLWKLL LIVSLSCLMA RLSFPVEIAS YFEFIIWLRF PIIAILLGIE LFLIVSVIKA       120
     LWQARNLSGD PRINILEQFG QEDDRKRSMA LALAMEPASW FYAIPRFSRK HPPSVTHINL       180
     LSASRWHWLL LACATVLLAG ASYVVIQPWS EITAIIVSSF ILYGLILITA NYRVSRHFSV       240
     YRHGDQLIIN NGVWGFSLVK FDQIHRVMVS PPPCENRTGV INFGQGESSN IILKFKHPQT       300
     YFGGLGWLPE EVKAIAMVVD KPEALADLIF DISDERELEV RRAELTPSWK ESISQEVFEG       360
     NADMPTELTS                                                              370
//

If you have problems or comments...

PBIL Back to PBIL home page