(data stored in ACNUC7421 zone)

EMBL: CP000821.PE472

CP000821.PE472       Location/Qualifiers
FT   CDS             584339..585871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0472"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sdn:Sden_3419 kap P-loop"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35085"
FT                   /db_xref="InterPro:IPR011646"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQG2"
FT                   /protein_id="ABV35085.1"
FT                   /translation="MDPVIDEAQLARMERAKTFASKYEDWQPEYNWGNCKTNRQEYGKF
FT                   LCSFLTNSKDGLVVNLNGSWGTGKTQLLRRLYVELAEQNHPVVYINAWESDFCNDALSV
FT                   VSSEFLNQLGFIFSSNADKSITEKFNELKDGFGTCMKLLSGGASLVGEPVTAATASAAG
FT                   SVVDTLPKAESNSVVSNNVELVDKISQAHANRVLAMQDIKKQITALSLLMNEIHDLEAP
FT                   IVVLVDELDRCRPIYAIEMLEVIKHFFEAKGCVFLVATDTEALQHSVNAVYGAKFNSAS
FT                   YLKRFFARKIALSEISSLRYLKSKEFDFEKYSELGIRLHPFTKNQNYNIKYMAAVAKLI
FT                   GFELRDIDQVIQKFFASLDFIAKTRMNHKSDVINTVVLFTGIAEHHNGMTCFYNRESNV
FT                   HIDSEIRCVGNVLDGISVNDLMQSQLNAVVKVMSREVHSGGGSSISRGDNSNIECLKIQ
FT                   SYNFIRHATKRYDDFVFHEEMRSLIQLSESTVDRYWLWDDYKMLIELSGHIE"
     MDPVIDEAQL ARMERAKTFA SKYEDWQPEY NWGNCKTNRQ EYGKFLCSFL TNSKDGLVVN        60
     LNGSWGTGKT QLLRRLYVEL AEQNHPVVYI NAWESDFCND ALSVVSSEFL NQLGFIFSSN       120
     ADKSITEKFN ELKDGFGTCM KLLSGGASLV GEPVTAATAS AAGSVVDTLP KAESNSVVSN       180
     NVELVDKISQ AHANRVLAMQ DIKKQITALS LLMNEIHDLE APIVVLVDEL DRCRPIYAIE       240
     MLEVIKHFFE AKGCVFLVAT DTEALQHSVN AVYGAKFNSA SYLKRFFARK IALSEISSLR       300
     YLKSKEFDFE KYSELGIRLH PFTKNQNYNI KYMAAVAKLI GFELRDIDQV IQKFFASLDF       360
     IAKTRMNHKS DVINTVVLFT GIAEHHNGMT CFYNRESNVH IDSEIRCVGN VLDGISVNDL       420
     MQSQLNAVVK VMSREVHSGG GSSISRGDNS NIECLKIQSY NFIRHATKRY DDFVFHEEMR       480
     SLIQLSESTV DRYWLWDDYK MLIELSGHIE                                        510
//

If you have problems or comments...

PBIL Back to PBIL home page