(data stored in ACNUC7421 zone)

EMBL: CP000821.PE473

CP000821.PE473       Location/Qualifiers
FT   CDS             complement(586226..586804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0473"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_0343 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35086"
FT                   /db_xref="InterPro:IPR021130"
FT                   /db_xref="InterPro:IPR033653"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQG3"
FT                   /protein_id="ABV35086.1"
FT                   /translation="MKLTALTQPLYDHLYRDILQFRSTFDLPSEDETTLDDKADTLHTS
FT                   LAIEELTELAEADTRMEQADAIVDSVYVLMGRLVHLGATGVNDRIEISYVIDLLLHVAK
FT                   NREIDFVTCWDEVHSSNMSKVCRNEQELTETIEFYAKQGVEIVGSKKGDFIIAKCAKDV
FT                   DMAGKVVRQGKVLKSVYYRPADLAKLVKA"
     MKLTALTQPL YDHLYRDILQ FRSTFDLPSE DETTLDDKAD TLHTSLAIEE LTELAEADTR        60
     MEQADAIVDS VYVLMGRLVH LGATGVNDRI EISYVIDLLL HVAKNREIDF VTCWDEVHSS       120
     NMSKVCRNEQ ELTETIEFYA KQGVEIVGSK KGDFIIAKCA KDVDMAGKVV RQGKVLKSVY       180
     YRPADLAKLV KA                                                           192
//

If you have problems or comments...

PBIL Back to PBIL home page