(data stored in ACNUC7421 zone)

EMBL: CP000821.PE476

CP000821.PE476       Location/Qualifiers
FT   CDS             complement(589131..591197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0476"
FT                   /product="peptidase S9, prolyl oligopeptidase active site
FT                   domain protein"
FT                   /note="KEGG: shn:Shewana3_0482 peptidase S9, prolyl
FT                   oligopeptidase active site domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35089"
FT                   /db_xref="GOA:A8FQG6"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR002470"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQG6"
FT                   /protein_id="ABV35089.1"
FT                   /translation="MKTHKILPSVLSTALAASLFITGCSQTPSPTNLSDRATIQDQSQQ
FT                   VQLLPVEAFFNEQGISGLKSSSDGKWLAFFKEYQGAKNIYLMATGTDLDEAFPITTSKD
FT                   PIYSFRWSHQGNEIFFLKDTGGNENTQIYKLSLDTSQIKPVPNITALTSNTDIRYDLLK
FT                   QPKDKPNTLVVMSNQDNPQQMDLFRLNIDSAKITNIFSNTYGFSSIETNQQGVPVLGTS
FT                   SNPDNTSDLYAKISGKWTSLIKTQFGEDIDILSFDEDNNLAYLRANIQGRDKLQLLRLN
FT                   MTTGKIVTLHQDPQDESDVYDVLFNDEGAPLAVSYYGGRLRTYPLDETFADNWQKINDH
FT                   FTQDVEITITDRNEKTGLWQLHIASDVDMGSDYRFDANTGLVSLLLEQEASISPELLSK
FT                   RQSITYQARDGVTIQAYLTLPKGQTQNLPTVILPHGGPWSRDYWTLSSGYFNPIAQLLA
FT                   NRGYAVLQPNFRASTGFGKRFLNAGNKNWGTGSMQDDLTDGAHYLIKEGIADKQRLGIM
FT                   GASYGGYAALAGATFTPDLYQAVISYVGPSSLITLLESFPPHFRPYLGQFYSAVGDPEI
FT                   DTDRVDMKARSPINFVDNIRAPLMLVQGANDPRVTQIESDNIARVMYNRKLPVEYILAK
FT                   DEGHGFRKRDNKLAYIVAMEQFFGKHLGGRVDNAVTPALTAHLDTLKVDVSRL"
     MKTHKILPSV LSTALAASLF ITGCSQTPSP TNLSDRATIQ DQSQQVQLLP VEAFFNEQGI        60
     SGLKSSSDGK WLAFFKEYQG AKNIYLMATG TDLDEAFPIT TSKDPIYSFR WSHQGNEIFF       120
     LKDTGGNENT QIYKLSLDTS QIKPVPNITA LTSNTDIRYD LLKQPKDKPN TLVVMSNQDN       180
     PQQMDLFRLN IDSAKITNIF SNTYGFSSIE TNQQGVPVLG TSSNPDNTSD LYAKISGKWT       240
     SLIKTQFGED IDILSFDEDN NLAYLRANIQ GRDKLQLLRL NMTTGKIVTL HQDPQDESDV       300
     YDVLFNDEGA PLAVSYYGGR LRTYPLDETF ADNWQKINDH FTQDVEITIT DRNEKTGLWQ       360
     LHIASDVDMG SDYRFDANTG LVSLLLEQEA SISPELLSKR QSITYQARDG VTIQAYLTLP       420
     KGQTQNLPTV ILPHGGPWSR DYWTLSSGYF NPIAQLLANR GYAVLQPNFR ASTGFGKRFL       480
     NAGNKNWGTG SMQDDLTDGA HYLIKEGIAD KQRLGIMGAS YGGYAALAGA TFTPDLYQAV       540
     ISYVGPSSLI TLLESFPPHF RPYLGQFYSA VGDPEIDTDR VDMKARSPIN FVDNIRAPLM       600
     LVQGANDPRV TQIESDNIAR VMYNRKLPVE YILAKDEGHG FRKRDNKLAY IVAMEQFFGK       660
     HLGGRVDNAV TPALTAHLDT LKVDVSRL                                          688
//

If you have problems or comments...

PBIL Back to PBIL home page