(data stored in ACNUC7421 zone)

EMBL: CP000821.PE477

CP000821.PE477       Location/Qualifiers
FT   CDS             591383..591898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0477"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shn:Shewana3_0483 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35090"
FT                   /db_xref="GOA:A8FQG7"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQG7"
FT                   /protein_id="ABV35090.1"
FT                   /translation="MNANMQKLMKISGFFRLLVLIATTIMMVYLGYSFFVNGDIRFGAS
FT                   HLFHELWQDERASRGILLGLQSPLFIILLVGVYWLQKLLSHYQQGQFFGHEAMRCYLWL
FT                   VWLKVFDFGIEIIQHLGTGYYHKQFFEHTSIQLTIDFGDVTTILLMLLIVYLLKAAREL
FT                   EAENREFI"
     MNANMQKLMK ISGFFRLLVL IATTIMMVYL GYSFFVNGDI RFGASHLFHE LWQDERASRG        60
     ILLGLQSPLF IILLVGVYWL QKLLSHYQQG QFFGHEAMRC YLWLVWLKVF DFGIEIIQHL       120
     GTGYYHKQFF EHTSIQLTID FGDVTTILLM LLIVYLLKAA RELEAENREF I                171
//

If you have problems or comments...

PBIL Back to PBIL home page