(data stored in ACNUC7421 zone)

EMBL: CP000821.PE480

CP000821.PE480       Location/Qualifiers
FT   CDS             complement(592835..593263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0480"
FT                   /product="cytochrome c biogenesis protein"
FT                   /note="KEGG: shw:Sputw3181_0575 cytochrome c biogenesis
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35093"
FT                   /db_xref="GOA:A8FQH0"
FT                   /db_xref="InterPro:IPR005616"
FT                   /db_xref="InterPro:IPR038297"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQH0"
FT                   /protein_id="ABV35093.1"
FT                   /translation="MMRILFLMLLFSLSMSAMAATTTTGENSYTQDQIRDIGFEISYEL
FT                   RCPMSINQNLFDSQAPIANELKAQIFLMLEQGESKEAIIEFLVQRYGEKIKYQPSFSVA
FT                   TAMLWFGPLFLLLIIIAVAAMLIREQHKHQRTNGNSYE"
     MMRILFLMLL FSLSMSAMAA TTTTGENSYT QDQIRDIGFE ISYELRCPMS INQNLFDSQA        60
     PIANELKAQI FLMLEQGESK EAIIEFLVQR YGEKIKYQPS FSVATAMLWF GPLFLLLIII       120
     AVAAMLIREQ HKHQRTNGNS YE                                                142
//

If you have problems or comments...

PBIL Back to PBIL home page