(data stored in ACNUC7421 zone)

EMBL: CP000821.PE481

CP000821.PE481       Location/Qualifiers
FT   CDS             complement(593260..595230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0481"
FT                   /product="cytochrome c-type biogenesis protein CcmF"
FT                   /note="KEGG: shw:Sputw3181_0576 cytochrome c-type
FT                   biogenesis protein CcmF"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35094"
FT                   /db_xref="GOA:A8FQH1"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="InterPro:IPR003567"
FT                   /db_xref="InterPro:IPR003568"
FT                   /db_xref="InterPro:IPR032523"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQH1"
FT                   /protein_id="ABV35094.1"
FT                   /translation="MIPELGLILLIISTVSSLLLAVIPLVALHTKNHYLFSYVKTLTGL
FT                   MTFTITASILCLLISFITDDFSVAYVANHSNTQLALLYKVAAVWGSHEGSMLFWVVAIA
FT                   IWGCIIVFSSKYRDRLFIGRLIAILASVIAGFNLFMLFTSNPFARLLPNFPIEGRDLNP
FT                   ILQDIGLIFHPPLLFLGYVGLTVTFAAAIAALLGGKLTRTHAGYLRPWALLAWVFLTGG
FT                   NAFGSWWAYNELGWGGWWFWDPVENASFIPWLVATALLHSVVLSHRRDSFKVTTLLLCL
FT                   LAFSLSLLGTFLVRSGIVQSVHAFASDPTRGMSILFLLGVFVCGALTLFALKANQIKSE
FT                   LNFTLVSRDSVILLGNIVLVVAAISVLLGTFYPLLFELLDIGTLSVGAPYFNSIFIPLT
FT                   FMAVLLMGAAPLISWKREKFSALRPLIVLFIIALAIAETLSMLTGSGFNIWLFLGATSA
FT                   TWLILCLGYLLFRLRHQGIEGLARKSAMLIAHLGVAISIIGATSVSNFEQQELLRMGPA
FT                   QGKVVAGYTFVYEDTVNVDEKSYTAIQANIRVTDADDNFIGYITPQRQTFKTNAMEVSK
FT                   AGIMRNIFRDLYVSSGLQLSDTEYLIRISYKPLACWIWLGGLLMMLGGTIAALTGLYRL
FT                   RVQKAAYSNSNPIATRIEGLA"
     MIPELGLILL IISTVSSLLL AVIPLVALHT KNHYLFSYVK TLTGLMTFTI TASILCLLIS        60
     FITDDFSVAY VANHSNTQLA LLYKVAAVWG SHEGSMLFWV VAIAIWGCII VFSSKYRDRL       120
     FIGRLIAILA SVIAGFNLFM LFTSNPFARL LPNFPIEGRD LNPILQDIGL IFHPPLLFLG       180
     YVGLTVTFAA AIAALLGGKL TRTHAGYLRP WALLAWVFLT GGNAFGSWWA YNELGWGGWW       240
     FWDPVENASF IPWLVATALL HSVVLSHRRD SFKVTTLLLC LLAFSLSLLG TFLVRSGIVQ       300
     SVHAFASDPT RGMSILFLLG VFVCGALTLF ALKANQIKSE LNFTLVSRDS VILLGNIVLV       360
     VAAISVLLGT FYPLLFELLD IGTLSVGAPY FNSIFIPLTF MAVLLMGAAP LISWKREKFS       420
     ALRPLIVLFI IALAIAETLS MLTGSGFNIW LFLGATSATW LILCLGYLLF RLRHQGIEGL       480
     ARKSAMLIAH LGVAISIIGA TSVSNFEQQE LLRMGPAQGK VVAGYTFVYE DTVNVDEKSY       540
     TAIQANIRVT DADDNFIGYI TPQRQTFKTN AMEVSKAGIM RNIFRDLYVS SGLQLSDTEY       600
     LIRISYKPLA CWIWLGGLLM MLGGTIAALT GLYRLRVQKA AYSNSNPIAT RIEGLA           656
//

If you have problems or comments...

PBIL Back to PBIL home page