(data stored in ACNUC7421 zone)

EMBL: CP000821.PE483

CP000821.PE483       Location/Qualifiers
FT   CDS             597859..598314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0483"
FT                   /product="rhodanese domain protein"
FT                   /note="KEGG: shw:Sputw3181_0578 rhodanese domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35096"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQH3"
FT                   /protein_id="ABV35096.1"
FT                   /translation="MVEANKRIIMNKVLGIIILTFFLAALSPNSFAGGGSDMAPAKHHE
FT                   FQLNHITMVEAETLVGKEGVYFFDVNTLELWAEGYIPGAIYFNVRDWKKILPENKDAVM
FT                   VFYCANRLCNASEIAARAVMKLGYTGVRQMPDGIYGWRLSNRQTERP"
     MVEANKRIIM NKVLGIIILT FFLAALSPNS FAGGGSDMAP AKHHEFQLNH ITMVEAETLV        60
     GKEGVYFFDV NTLELWAEGY IPGAIYFNVR DWKKILPENK DAVMVFYCAN RLCNASEIAA       120
     RAVMKLGYTG VRQMPDGIYG WRLSNRQTER P                                      151
//

If you have problems or comments...

PBIL Back to PBIL home page