(data stored in ACNUC7421 zone)

EMBL: CP000821.PE485

CP000821.PE485       Location/Qualifiers
FT   CDS             599191..599898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0485"
FT                   /product="Cytochrome c biogenesis factor-like protein"
FT                   /note="KEGG: shn:Shewana3_0492 formate-dependent nitrite
FT                   reductase, NrfG protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35098"
FT                   /db_xref="GOA:A8FQH5"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQH5"
FT                   /protein_id="ABV35098.1"
FT                   /translation="MNILLISIVALCVLLLMTFFGHHTLYRIKHTSFFSDCNELDSNRT
FT                   KYSRSSFSFVLLLNVTVITSVVTVYSYLGRYNEIDLARADVNVDYLLAAEINRARKQAN
FT                   EQPNDKSVLMGLARASMDGGLYLEAIEALDELLFYMGDDAEIIGLKATALYYKNHRSMT
FT                   SEVKLLTQSALALYPHDFNTRVLLANDAYINHKYQEAISHWQILLKNTKQPFNRNAIEF
FT                   AINNAKKNLFAKK"
     MNILLISIVA LCVLLLMTFF GHHTLYRIKH TSFFSDCNEL DSNRTKYSRS SFSFVLLLNV        60
     TVITSVVTVY SYLGRYNEID LARADVNVDY LLAAEINRAR KQANEQPNDK SVLMGLARAS       120
     MDGGLYLEAI EALDELLFYM GDDAEIIGLK ATALYYKNHR SMTSEVKLLT QSALALYPHD       180
     FNTRVLLAND AYINHKYQEA ISHWQILLKN TKQPFNRNAI EFAINNAKKN LFAKK            235
//

If you have problems or comments...

PBIL Back to PBIL home page