(data stored in ACNUC7421 zone)

EMBL: CP000821.PE486

CP000821.PE486       Location/Qualifiers
FT   CDS             599949..600653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0486"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein"
FT                   /note="KEGG: she:Shewmr4_0492 4Fe-4S ferredoxin,
FT                   iron-sulfur binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35099"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQH6"
FT                   /protein_id="ABV35099.1"
FT                   /translation="MSENLERRRFLKCLGASSLIIAPLGCSSVEEEGESDQPHYTMVFD
FT                   QNKCTGCGECKLACTTANNLPEGKSRLLLEQQSGGVVGEVCPHCGKTDCDCQRKYVRVS
FT                   CQQCKNAPCVTVCPTGAAHRDEKTGIVTMDASKCAGCKYCIGACPYDARFINKETDVAD
FT                   NCDFCLNSKLSKGELPACVQACRYDALIFGDLNDPNSYVSKLLRVKDAVRMKPGFGTEP
FT                   SLRYIPIVKLGV"
     MSENLERRRF LKCLGASSLI IAPLGCSSVE EEGESDQPHY TMVFDQNKCT GCGECKLACT        60
     TANNLPEGKS RLLLEQQSGG VVGEVCPHCG KTDCDCQRKY VRVSCQQCKN APCVTVCPTG       120
     AAHRDEKTGI VTMDASKCAG CKYCIGACPY DARFINKETD VADNCDFCLN SKLSKGELPA       180
     CVQACRYDAL IFGDLNDPNS YVSKLLRVKD AVRMKPGFGT EPSLRYIPIV KLGV             234
//

If you have problems or comments...

PBIL Back to PBIL home page