(data stored in ACNUC7421 zone)

EMBL: CP000821.PE488

CP000821.PE488       Location/Qualifiers
FT   CDS             601920..602420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0488"
FT                   /product="NosL family protein"
FT                   /note="KEGG: she:Shewmr4_0494 NosL family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35101"
FT                   /db_xref="InterPro:IPR008719"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQH8"
FT                   /protein_id="ABV35101.1"
FT                   /translation="MKKIICLLFLLPLLLACTQGAEDVPQAKAEAIEKHERCHLCGMMI
FT                   TKYPGPKGQVHLKGQSVVPKFCSTRDMFNFSLQAENKRQISALFVHDMGATDWEQPGDD
FT                   AFIDAFIDAKTAWYVYGTSKKAVMGPAVASFKRQSQAVKFAQEFGGAVLPFEQVDLALL
FT                   SGE"
     MKKIICLLFL LPLLLACTQG AEDVPQAKAE AIEKHERCHL CGMMITKYPG PKGQVHLKGQ        60
     SVVPKFCSTR DMFNFSLQAE NKRQISALFV HDMGATDWEQ PGDDAFIDAF IDAKTAWYVY       120
     GTSKKAVMGP AVASFKRQSQ AVKFAQEFGG AVLPFEQVDL ALLSGE                      166
//

If you have problems or comments...

PBIL Back to PBIL home page