(data stored in ACNUC7421 zone)

EMBL: CP000821.PE490

CP000821.PE490       Location/Qualifiers
FT   CDS             603793..604701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0490"
FT                   /product="ABC transporter-related protein"
FT                   /note="KEGG: slo:Shew_0356 ABC transporter-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35103"
FT                   /db_xref="GOA:A8FQI0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQI0"
FT                   /protein_id="ABV35103.1"
FT                   /translation="MLSEVPIKLTDIVLKYDDFTALDGVSFEVEAGQTMALLGHNGAGK
FT                   SSIIKVILGLIAPSSGSVKIMGKSAQSSHLQHKVNLGYLPEDVSFYDKLTGREVLNYFA
FT                   ALKRVRPTRVADLIDEFGLGYAQDRQLKTYSKGMKQRLGVAQAILSEPGILLLDEPTVG
FT                   LDPQASQFLYGKINQLKNSGCAVVVSTHELPLVESHMDSALIMSKGRRLAQGTSSELSA
FT                   GSSLKAKIDFGELTSLVERDHYLRRFFIDGRLQVESGQKQHMIKYLVSQCQIFDFTIDE
FT                   PKLEDIYHDLMVHPLLDQPAQ"
     MLSEVPIKLT DIVLKYDDFT ALDGVSFEVE AGQTMALLGH NGAGKSSIIK VILGLIAPSS        60
     GSVKIMGKSA QSSHLQHKVN LGYLPEDVSF YDKLTGREVL NYFAALKRVR PTRVADLIDE       120
     FGLGYAQDRQ LKTYSKGMKQ RLGVAQAILS EPGILLLDEP TVGLDPQASQ FLYGKINQLK       180
     NSGCAVVVST HELPLVESHM DSALIMSKGR RLAQGTSSEL SAGSSLKAKI DFGELTSLVE       240
     RDHYLRRFFI DGRLQVESGQ KQHMIKYLVS QCQIFDFTID EPKLEDIYHD LMVHPLLDQP       300
     AQ                                                                      302
//

If you have problems or comments...

PBIL Back to PBIL home page